SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003368 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003368
Domain Number 1 Region: 1138-1333
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 928-1051
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-32
Family Pleckstrin-homology domain (PH domain) 0.000000459
Further Details:      
 
Domain Number 3 Region: 46-167
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-20
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003368   Gene: ENSOARG00000003154   Transcript: ENSOART00000003432
Sequence length 1607
Comment pep:known_by_projection chromosome:Oar_v3.1:13:24527960:24654525:-1 gene:ENSOARG00000003154 transcript:ENSOART00000003432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATRRTGLPEGDVDTKLKACGSPTCEVSTSKDGKEQSETISPSEDEMFSWPGPKTVMLK
RTSQGFGFTLRHFIVYPPESAIQFSFKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAF
EAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVAYSQDAYLK
GNEAYSGNARNIPEPPPVCYPWPSSAPPAMAQPPEPPPPDSTASKPQTSPPVLTQPGRAY
RMEIQVPPSPPEVAKSNTAVCVCNESVRTVIVPSEKVVDLLPNRSNHTVPAHRTEEVRYG
RNEQPSFKTATRTTSPPSSVPTAHLIHQPGSRSLEPSGILLKSGHYGGHSEGLVSRSPAV
ESPSVTVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHMGCRTIQERLDSLRAASQSTADYN
QVVLNRAALQVRRRSTSQDRVPQSIQVRQRSVSQERLEDSVLMMYCPRSASQGALTSPSI
SFSNHRTRSWDYIEGQGETSENVHSECPPPDANGERKQTYKWSGFTEQDDRRGIYERSRQ
QEIHKSFRGSNFTVAPSVVNSDSRRMSSRVGGSVSQFKKIPADLKPLQPSRNFQTTCGMS
QPRGISQDRSPLGKVRSNSLKAPSTHVPKPPSSQNSFVSIKDQRPVNHLHQNSLFNQQTW
LRTESAPDHQVDTGKPPSLSGASVKPPALASENASTPDFELSVTQRNQDLNVQEVEIQQS
NAVDNKETVILREKPPSGRQTPQPLRHQSYILAVSDQETGSDTTCWLPNDARREVHIKRM
EERKASSTTPPGDSLASIPFIDEPTSPSIDHDISHIPASAVISASTSQVPSIATVPPSLT
TSAPLIRRQLSHDQESVGPPSLDAQPSSKTERSKSYDEGLDDYREDAKLSFKHVSSLKGI
KILDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLR
GHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRD
DMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEPLPKTPRQSLSIRQTLL
GAKAEPRTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPTATGTFG
VRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADI
DIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRLIHDL
PEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYK
IVETLIQHHDWFFTEEGAEEPLTTVQEENTVDSQPVPNIDHLLTNIGRTGVSPGDVSDSA
TSDSTKSKGSWGSGKDQYSRDLLVSSIFAAASRKRKKPKEKAQPSSSEDELDNVFFKKEN
SEQGHHDIKEESKKESETQGRKQRTVAPKENNTKKDSSGGGRAEQRAPRGESLEPPAPQS
TKQSRSPTLSCRLAVLRESPRALAAQKTSHLEDTGSDSGTPLSTRAPAPLASFPTRKPPS
PEPKHSELLVSVGSITSDYAGAPSAPYLACIVYHRHCPFKVEPGRRS
Download sequence
Identical sequences W5NYX0
ENSOARP00000003368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]