SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003536 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003536
Domain Number 1 Region: 505-764
Classification Level Classification E-value
Superfamily NHL repeat 1.99e-47
Family NHL repeat 0.00000736
Further Details:      
 
Domain Number 2 Region: 355-451
Classification Level Classification E-value
Superfamily E set domains 1.67e-22
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 45-119
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000243
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 4 Region: 136-197
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000366
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003536   Gene: ENSOARG00000003318   Transcript: ENSOART00000003600
Sequence length 766
Comment pep:known_by_projection chromosome:Oar_v3.1:17:4187247:4308588:-1 gene:ENSOARG00000003318 transcript:ENSOART00000003600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRRGGYGIPQQRAGSKTAGPPCQWSRMASEATSIPSPVVRQIDKQFLICSICLERYKNP
KVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRS
PGSSAEESSILETVTAVAAGKPLSCPNHDGNVMDFYCQSCETAMCRECTEGEHAEHPTVP
LKDVVEQHKASLQVQLDAANRRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQK
TLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLEGQESIKSCSSFTAQALNHGTETEVLLV
KKQMSEKLSELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVATGEGLRQT
IIGQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKE
GDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMY
STGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQ
FKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGP
KGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIV
TDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDG
SGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences W5NZD8
ENSOARP00000003536 XP_004017238.2.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]