SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003749 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003749
Domain Number 1 Region: 6-172
Classification Level Classification E-value
Superfamily RUN domain-like 4.18e-51
Family RUN domain 0.000000245
Further Details:      
 
Domain Number 2 Region: 537-604
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.01e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000003749
Domain Number - Region: 183-262
Classification Level Classification E-value
Superfamily Prefoldin 0.00126
Family Prefoldin 0.0099
Further Details:      
 
Domain Number - Region: 329-426
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00915
Family Myosin rod fragments 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003749   Gene: ENSOARG00000003509   Transcript: ENSOART00000003816
Sequence length 608
Comment pep:novel chromosome:Oar_v3.1:5:1400052:1452014:-1 gene:ENSOARG00000003509 transcript:ENSOART00000003816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASKGQMMEERVNLMHMMKLSIKVLLQSALSLGRSLDADHAPLQQFFVVLEHCLKHGLRVK
KSFIGQNKSFFGPLELVEKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADY
LKVLVDNKNLLSEFYEPEALMMEEEGTVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFS
LYIKDVQDLDGRKDKEHERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQE
ELSAATDRICSLQEEQQQLREQNELIREKSEKSVEITKQDTKVELETYKQTRQGLDEMYN
DVWKQLKQERKARLELEKELELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKA
INLQMFHKVQNAESSLQQKNEVITSFEEKTNQVTSSMKQMEDRLRHSESARQGAEERSRK
LQQELGGRSSALQQQLAQLHEQCASLEKELKSEKEQRQALQRELQHEKDTSSLLRAELQQ
VEGLKKELRELQDEKAELQKICDEQEQALQEMGLHLSQSKLKMEDIKEVNKALKGHTWLK
DDEATHCKQCEKEFSISRRKHHCRNCGHIFCNACSSNELALPSYPRPVRVCDSCHTLLLQ
RCSSSTSS
Download sequence
Identical sequences W5P001
ENSOARP00000003749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]