SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003919 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003919
Domain Number 1 Region: 51-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000109
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 2 Region: 114-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003919   Gene: ENSOARG00000003676   Transcript: ENSOART00000003988
Sequence length 255
Comment pep:known_by_projection chromosome:Oar_v3.1:5:14632050:14636416:-1 gene:ENSOARG00000003676 transcript:ENSOART00000003988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGWVARGLSRRAAALGLGLRVLLGFGLCPETAPTPIQTWSPTQAPGPSAGSCPPTDFQC
RSDGRCVPLIWRCDVDQDCLDGSDEEECGTEVPNVSPSPCDIMDDCPDRNKSLLNCGPQP
CPKGELCCLLDGLCIPTTWLCDGHRDCSDYSDELGCGNKTHQEGRTMSTGTPATLENVTY
LRNATVTTIEDWDSVQSGNRSAYGIIAAVAVLSASLAAGILFALSRLCAQGCLDPLGLLV
FVKGSLQPERKTSVL
Download sequence
Identical sequences W5P0H1
ENSOARP00000003919 XP_004008613.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]