SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004080 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004080
Domain Number 1 Region: 126-306
Classification Level Classification E-value
Superfamily MIR domain 3.4e-49
Family MIR domain 0.002
Further Details:      
 
Domain Number 2 Region: 988-1101
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-18
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 3837-3915
Classification Level Classification E-value
Superfamily EF-hand 0.000000000741
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 566-714
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000633
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 10-91
Classification Level Classification E-value
Superfamily MIR domain 0.00000379
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 339-455
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000549
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 1972-2037
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000942
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000004080
Domain Number - Region: 1237-1358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000388
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004080   Gene: ENSOARG00000003817   Transcript: ENSOART00000004152
Sequence length 4788
Comment pep:known_by_projection chromosome:Oar_v3.1:25:10061438:10523859:1 gene:ENSOARG00000003817 transcript:ENSOART00000004152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHP
ASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAA
QGYLIGGDVLRLLHGHLDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAW
SGSHIRWGQPFRLRHVTTGKYLSLMEDKSLLLMDKEKADVKSTAFTFRSSKTFKEKLDVG
VRKEVDGMGTSEIKYGDSVCYIQHINTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDD
GLNLSRSQHEESRTARVIRSTVFLFNRFISVKKVKASTVDLPIESVSLSLQDLIGYFHPP
DEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESW
KSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEAL
NIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQT
RLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPY
PGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSI
SFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAV
LPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLA
ENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLAL
GCHVGISDEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNV
WARDRIRQGWTYGIQQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEA
PDQDHAARAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEAITSGDMRVGWSRPGCQPDQ
ELGSDERAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMTEHTMMFTLNGEILLDDS
GSELAFKDFDVGDGFIPVCSLGVAQVGRLNFGKDVSTLKYFTICGLQEGYEPFAVNTNRD
ITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSSTDIMFYRLSM
PIECAEVFSKSYCLTPSLLNERDDYDYLMQTSTTILQYYYSVRIFPGQEPANVWVGWITS
DFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESLSPGQGRNNNGLEIG
CVVDAASGLLTFTANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSA
GLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCVEPLQFM
SLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYA
IENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDEKKKHGL
PGIGLSTSLRPRMQFSSPSFVSINTEGYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARD
PVGGTTEFLFVPLIKLFYTLLIMGVFHNEDLKHVLQLIEPSVFKEAASPEEESEVAEKEP
FVEDSKLEGAAEEENKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAF
SDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPC
PEEIRDQLLDFHEDLMTHCGIELDEDRSLDGNNDLTIRGRLLSLVEKVTYLKKKQAEKPV
ESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTI
NGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMH
ETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVG
LASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDI
GWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLSAME
EAIKIAEDPSRDGPSPTTGSSRTPDTEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHL
IHAAKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKAAM
VLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLL
TRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHL
LRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGI
FDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDT
SNITIPEKLEYFINKYAEHAHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEK
EIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDM
SNVTLSRDLHAMAEMMAENYHNIWAKKKKLELEAKGGGNHPLLVPYDTLTAKEKAKDREK
AQDILKFLQINGYAVSSHPRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDG
GSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVT
SLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLDNAA
EDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILED
VQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYN
TKSSRERAALNLPTNVEDVCPNIPSLEKLMEEIVDLAESGIRYTQMPHVMEVILPMLCSY
MSRWWEHGPENNPGRAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAGVRET
VFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKSEARGDMSEAELLILDEFT
TLARDLYAFYPLLIRFVDYNRSRAKWLKEPNQEAEDLFRMVAEVFIYWSKSHNFKREEQN
FVVQNEINNMSFLIMDTKSKMSKKLVQMKAAVSDQERKKMKRKGDRYSMQTSLIVAALKR
LLPIGLNICAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYK
DLPNRTEDTSDPEKTVERVLDIANVLFHLEQVEHPQRSKKAVWHKLLSKQRKRAVVACFR
MAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKRVDPL
HQLILLFSRTALTEKCKLEEDFLYMAYADIMAKMYQSCHDEEDDDGEEEVKSFEEKEMEK
QKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYL
KEKKDVGFFQSLAGLMQSCSYCSVLDLNAFERQNKAEGLGMVTEEGSVITHERGEKVLQD
DEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYY
SGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFA
HMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEM
ILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAET
DENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPF
LGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNF
CEDTIFEMQLAAQISESDLNERSANKEESEKEKPEEQGPRMGFFSIMTVKSALFALRYNI
LTLMRMLSLKSLKKQVKKVKKMTVKDMITAFFTSYWSILMSLLHFVASVFRGFSRIIGSL
LLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEEGERKTLEGALPSEDLTDLKELTEE
SDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPIPEVQEKFQEQKANEEEKEEK
EESKSEPEKAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLL
NYFARNFYNMRMLALFVAFAINFILLFYKVRKELPTRSSSENARVSSLDSSSPRIIAVHY
VLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITE
QPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDF
SDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSILGHYNNFFF
AAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDG
DTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILL
AIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYL
FFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences W5P0Y1
ENSOARP00000004080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]