SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004687 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004687
Domain Number 1 Region: 232-484
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.16e-64
Family Eukaryotic proteases 0.000000563
Further Details:      
 
Domain Number 2 Region: 52-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-23
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000004687
Domain Number - Region: 196-241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00032
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004687   Gene: ENSOARG00000004379   Transcript: ENSOART00000004768
Sequence length 488
Comment pep:known_by_projection chromosome:Oar_v3.1:3:207275702:207285576:1 gene:ENSOARG00000004379 transcript:ENSOART00000004768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSRCLVSELWELSLGKPHSTRCPGNMWWFLLWGVLQAFPTQGSVVLLAQWLPQNLTSP
GYPEPYVKGQESSTDIEAPESYAVRLLFQDFDLEPSPDCEQDSVTITANGMDLGKFCGQQ
GSLLGRPPGQREFVSSGNSLRLTFSARASEDKTPGLHKGFLALYQAVAVNYTQPINQATG
GPKAIHKPGDNPAEIQSCCQEPYYKAKTSGTLTCTAQVPWKQTQKREEAPRCMPVCGRPV
VPISQTQESLGTSRAELGSFPWQALTSIYGRGGGALLGDRWVLTAAHTIHPKDSILLGRN
RSAQVFLGYTDTDQMLELGGHPVRRVVVHPDYHRDDPHNFHGDIALLELEHSVPLGRHLL
PVCLPPRRRPGRWGYVSGFGVEMGWLSTKLKYSRLPVAPRAACEAWLRERQRPEAFTNGM
FCAGDQTRPQSVCQGDSGGAFVVWDDRARRWVATGIVSWGVGCGEGYGFYTKVLDYVDWI
RRVMGEKD
Download sequence
Identical sequences W5P2N7
ENSOARP00000004687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]