SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004909 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004909
Domain Number 1 Region: 39-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.38e-36
Family SCAN domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 410-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 745-802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 802-858
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 914-970
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 633-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 858-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 466-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 215-271
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 11 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 690-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 13 Region: 369-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 955-1005
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000101
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004909   Gene: ENSOARG00000004589   Transcript: ENSOART00000004992
Sequence length 1041
Comment pep:known_by_projection chromosome:Oar_v3.1:19:16330147:16341659:1 gene:ENSOARG00000004589 transcript:ENSOART00000004992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMTRENWAHSALRQEGLVKGKDDTWKWGTSFQGSSSTVWETSHLHFRQLRYHETSGPQ
EALSRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQIHRPGSGEEAVALV
EELQKDLDGPTLKVPAFVQDQDTFQEGLSTPGIELPHAPTGSHISAEIRSNSLTDPVVFG
LLQDPQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLSP
VQRALYWDVMLENYGNVTSLEWETMTENEEVTSKLNISQRADSQRGISKRFQGGVPQLLD
FEEECEWQVFSSQWGNEAKERDTLKKGSLCERDKKKRTPPEKRGQKWKEFEESLASDSAF
SESLIGAEGKKLYKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHL
RNHSGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHS
GERPYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKP
YKCDECGKTFAQTTYLVDHQRLHSTENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCK
KCGKIFTSKSSLIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECSECGK
VFILKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIM
SKSFMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNL
IEHKRIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQ
RIHTGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHT
GEKPYKCSECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKP
YGCNDCSKVFRQRKNLTVHQKIHTDEKNCECDESEKEFSQTSNLHLQQKIHSLEDFGSYS
LGSKFSWVQNASESKIKIQKI
Download sequence
Identical sequences W5P3A9
ENSOARP00000004909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]