SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005179 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005179
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily RUN domain-like 1.57e-49
Family RUN domain 0.000000292
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000005179
Domain Number - Region: 189-252
Classification Level Classification E-value
Superfamily Prefoldin 0.00366
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005179   Gene: ENSOARG00000004833   Transcript: ENSOART00000005266
Sequence length 373
Comment pep:novel chromosome:Oar_v3.1:21:9154159:9155328:-1 gene:ENSOARG00000004833 transcript:ENSOART00000005266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVNLMHMMKLSIKVLLQSALSLGRSLDADHAPLQQFFVVLEHCLKHGLRVKKSFIGQNK
SFFGSSELVEKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLVDNK
NLLSEFYEPEALMMEEEGTVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLYIKDVQD
LDGGKEHERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRIC
SLQEEQQQITKQDTKVELETYKQTRQGLDEMYNDVWKQLKQERKAHLELEKELELQIGMK
TEMEIAMKLLEKNTHEKQDTLVALRQQLEEVKAINLQMFHKVQNAESSLQRKNEVITSFE
EKTNQVTSNMKQM
Download sequence
Identical sequences W5P427
ENSOARP00000005179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]