SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005331 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005331
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000546
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000178
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005331   Gene: ENSOARG00000004975   Transcript: ENSOART00000005418
Sequence length 615
Comment pep:known_by_projection chromosome:Oar_v3.1:1:104518391:104534191:-1 gene:ENSOARG00000004975 transcript:ENSOART00000005418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGSATHPGAGGRRSKWDQPAPAPLLFLPPATPGGEVTSSGGSPGGSTAAPSGALDAAA
AVAAKINAMLMAKGKLKPTQNAAEKLQAPGKGLTSNKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAISQKPPFQSGMHYVQDKLFVGLE
HAVPTFNVKEKVEGPGCTYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHP
KPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAISSVPPQPPYYPSNGY
QSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPAST
GQSPMSGPFIPAAPVKTALPAGPQPPPQPQPPLPSQPQAQKRRFTEELPDERESGLLGYQ
HGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDSRQLMPPPAFPVTGIKTESDERN
GSGTLTGSHDYPVKKMKTTEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPS
SQPRAKQQMPFWMAP
Download sequence
Identical sequences W5P4H8
ENSOARP00000005331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]