SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005389 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005389
Domain Number 1 Region: 17-181
Classification Level Classification E-value
Superfamily RUN domain-like 1.57e-48
Family RUN domain 0.000000154
Further Details:      
 
Domain Number 2 Region: 544-610
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.41e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00099
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000005389
Domain Number - Region: 229-327
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005389   Gene: ENSOARG00000005026   Transcript: ENSOART00000005476
Sequence length 614
Comment pep:known_by_projection chromosome:Oar_v3.1:25:24584745:24623457:-1 gene:ENSOARG00000005026 transcript:ENSOART00000005476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDSFLVLSATKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEH
CLKHGLKVRKSFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLKTPLGRARAWLRLA
LMQKKMADYLRCLIIQRDLLSEFYEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLD
SQVGVIDFSMYLKNEEDIGNKERNVQIAAILDQKNYVEELNRQLNSTVSSLHSRVDSLEK
SNTKLIEELAIAKNNIIKLQEENHQLRSENKLILMKTQQHLEVTKVDVETELQTYKHSRQ
GLDEMYNEARRQLRDESQLRQDVENELAVQVSMKHEIELAMKLLEKDIHEKQDTLIGLRQ
QLEEVKAINIETYQKLQGSEDGLKEKNEIIARLEEKTSKITAAMRQLEQRLQQAEKAQME
IEDEDKKYLQEYQSKLDSLQKQISQKEKQLAQLETDLKIEKEWRQTLREDLQKEKDTVSH
LRNETQQIITLKKEFLNLQDENQRLKKIYHKQEQALQELGNKLSESKLKIEHMKEANKAL
QGLVWLKDKEATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDS
CHALLIQRCSSNLP
Download sequence
Identical sequences W5P4N6
ENSOARP00000005389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]