SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005469 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005469
Domain Number 1 Region: 1206-1310,1376-1516
Classification Level Classification E-value
Superfamily Cullin homology domain 6.41e-39
Family Cullin homology domain 0.0013
Further Details:      
 
Domain Number 2 Region: 769-961
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-35
Family APC10-like 0.0077
Further Details:      
 
Domain Number 3 Region: 359-433
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.72e-32
Family CPH domain 0.00000674
Further Details:      
 
Domain Number 4 Region: 115-200,658-732
Classification Level Classification E-value
Superfamily ARM repeat 0.00000143
Family RPA1889-like 0.066
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000005469
Domain Number - Region: 1546-1599
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0871
Family SCF ubiquitin ligase complex WHB domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005469   Gene: ENSOARG00000005094   Transcript: ENSOART00000005556
Sequence length 1698
Comment pep:novel chromosome:Oar_v3.1:20:16727427:16741696:-1 gene:ENSOARG00000005094 transcript:ENSOART00000005556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPEELIRQRVGHDGHPEYQIRWLILRRGDDGEGGSNHVDC
KAEHILLWMSNDEIYANCHKMLGEDGQVIGPSQETAGEAGALDKSVLGEMETDVKSLIQR
ALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALASHDAGTRTQILFSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGI
QLPQVPGRLLFSLVKRYLHVTFLLDQLNDTAAEAGAPNSTPEELSGERGRLELEFSMAMG
TLISELVQAMRWDQAWSRQGPSGQPSGSIFQPQLVDEGPGLPPAQALPSRRRSRRFRPRS
EFASGNTYALYVRDALQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVLWESTGRTY
WVHWHMLEILGFEEDIENMVEAADEYQGAAVSAAVGTALPSWHWKPMTELYAVPYVLPED
EDAEESEHLTQAEWWELLFFIKKLDGPDHQEVLQILQENLDGEVLDDEVLAELAVPTELA
QDLLLALPQRLDDSALRDLLNCRVYRKYGPEALAGQPAYLSLLEAQAQPQESADAARVEA
KEAPTQGSNTPLQRLAEGFGPAGKIFLDLEGAFRSEGPRQGEARPLLLQLQRQPQPFLVL
MRSLDTPAANKPLHLAVLRILMQLVDFPEALLLPWHEAMDACMACLRSPNTDREVLQELI
LFLHRLASVSRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDMVFKCEKHAHLYRKL
TTNILGGCIQMVLGQIEDHRRTHRPINIPFFDVFLRYLCQGSSMEVKEDKCWEKVEVSSN
PHRASKLTDRNPKTYWESNGSAGSHRITLHMQQGTLIRQLALLVASEDLSYMPARVVVFG
GDSATSLNTELNSVNVMPSASRVVLLENLSCVWPVIQIRIKRCQQGGIDTRIRGLEVLGP
KPTFWPVFREQLCRHTRLFYMVRAQAWSQDIAEDRRGLLHLSSRLNGALRHEQNFASHFL
PDEEAAQALGKTCWEALVSPLVQNITCPDEEGVSPLGWLLDQYLECREAAHNPQSRAAAF
SSRVRRLTHLLVHVEPCEAPPAVAASPRPKGRNRSHDWSSLATRGLPSSIMRNLTRCWRA
VVEQQVHSFLTSRWRDDDFVPRYCEHFSNLQKASSELFGPRAAFLLALQNGCAGALLKLP
FLRAAHVSEQFARHIDQRIQGSRIGGARGMEMLAQLQRCLETVLIFSGLEIATTFEHYYQ
HYMADRLLGVGSSWLEGAVLEQIGPCFPSRLPQEILRSLSTSEELQRQFHVYQLQRLDQE
LLKLEDTEKKIQVSRDASASGRGHERGTGEEAELEAGAVAAAAAAGVAGEEEEEDESEDL
YYEGAMPEVSVLVLSPRCWPTASICHTLNPRTCLPAYLRGTLNRYSNFYNKRQSYPALER
APQRRLQWTWLGRAELQFGDQTLHVSTVQMWLLLHFNELKAVSVESLLAHSGLPPDVLNQ
AIGPLTSSRGPLDLDETKDTPAGLLKIRDGSEEPRPRRGNVWLIPAQTYLKAEDEEGRNL
EKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGRGSTCGSAD
VLSCILHLLGKGTVRRQDDRPQRLSYAVPVTVMEPHTESLNPGSLGPNPPLTFHTLQIRS
RGVPYASCTSTQSFSTFR
Download sequence
Identical sequences W5P4W6
XP_011956079.1.66739 ENSOARP00000005469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]