SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005719 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005719
Domain Number 1 Region: 13-221
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.59e-22
Family Nuclease 0.024
Further Details:      
 
Domain Number 2 Region: 318-364,414-477
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000583
Family TrmB middle domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005719   Gene: ENSOARG00000005330   Transcript: ENSOART00000005807
Sequence length 509
Comment pep:known_by_projection chromosome:Oar_v3.1:11:52780147:52803093:-1 gene:ENSOARG00000005330 transcript:ENSOART00000005807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPWLLLAPLLSPAVPAVTSPPCCLCAEGVHRFQWIRNLVPEFGVSSSHVRVLSSPAEFF
ELMKGQIKVAKRRVVMASLYLGIGPLEQELVDCLESTLEKSLQAKFPPGLRVSILLDFTR
GSRGRKNSRTMLLPLLQRFPEQVRVSLFHTPNLRGLLRLLIPERFNETIGLQHIKVYLFD
NNVILSGANLSDSYFTNRQDRYVFLQDCPEIADFFTELVDAVGDVSLQLQGDDSVQMVEG
MVHPYKGDRAAYCKAANKRVMDVINSARTRQQMLHAQTFHSDSLLTQEDAAAAGDRRPAP
DTWIYPLIQMKPFEIQIDEIVTETLLTEAERGAKVYLTTGYFNLTQAYMDLVLGTRAEYQ
ILLASPEGDGFFGARGVAGAIPAAYVHIERQFYSAVCSLGQQERVRLQEYWRRDWTFHAK
VRWLCPAGRSLPCLTLIGSPNFGYRSVHRDLEAQIAIVTESRALQQQFHQEQEQLYRRAG
VVSSATFEQPSRQVKLWVKMVTPLIKNFF
Download sequence
Identical sequences W5P5L6
ENSOARP00000005719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]