SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005954 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005954
Domain Number 1 Region: 20-224
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-45
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 256-448
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.54e-38
Family BAR domain 0.01
Further Details:      
 
Domain Number 3 Region: 589-672
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-20
Family SH3-domain 0.0006
Further Details:      
 
Domain Number 4 Region: 495-568
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000407
Family SH3-domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005954   Gene: ENSOARG00000005541   Transcript: ENSOART00000006044
Sequence length 675
Comment pep:known_by_projection chromosome:Oar_v3.1:5:58459873:58495649:1 gene:ENSOARG00000005541 transcript:ENSOART00000006044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSHGDDALSSRTGAPGGDDRLSEDRSLLQQRLAVRELLDTEVSYLHVLQLCASDIRSRL
QQLPQGDLDVLFSNIDDIIKVNSRLLHDLQETASREEEQVQLIGNTFLEFQEELEQVYKV
YCASYEQALLLVETYRKEPELQREIQGIIEAVLPQAGPSGLSFLLVIPLQRITKYPLLLQ
KILENTLPDASAYAVLQRATSALQDVVTNINEYKRRKEVASKYTKVEPLSLRERLARINT
HTLSKKTTRLSQLLKQEAGLVPRTEDKEFDDLEEKFHWVSLCVTELKSNVAAYLDNLEAF
LRFRPQDYNLEIPGGPVVQYCYLARDLQLQAFPEFKQQLEAQVWQPLCSLAKALAGPQNL
IKKRLDKLLDFERVEEKLLEVGSMTYEEEAARHTYQALNSLLVAELPQFNQLAMRWLSQI
LCAFVTLQRDLAKQVLQRAEDSLAQLPHHHLSEPAFRKLVEDALGQTSHQLRAFQENFEK
VLPPPTTQPLLPGAERQVQALLSRYGPGKLYQVTSNISGAGTLDLTLPRGHIVALLQNKD
TKGNSSRWLVDTGGHRGYVPAGKLEVYHVVPTEEELRGQARPHKDSEHQTPEPTSAPVPS
VPTVTQVVAVYPFVARSSHEVSLQAGQRVTVLEAHDKKGNPEWSLVEVNGQRGYVPSSFL
ARAPSPAPWGWSLPS
Download sequence
Identical sequences W5P6A0
XP_004009011.1.66739 ENSOARP00000005954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]