SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006575 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006575
Domain Number 1 Region: 570-597,636-714
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000147
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006575   Gene: ENSOARG00000006140   Transcript: ENSOART00000006678
Sequence length 734
Comment pep:known chromosome:Oar_v3.1:5:58803769:58818075:1 gene:ENSOARG00000006140 transcript:ENSOART00000006678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKNGEQNDLSPKDSVKGNDQYRSPSGIHVEHEEESRNDFWQFESSNLFRHPRIHLEPQ
EKSDNNLKKFVIKKLEKSCQCSSTKAKNTIFGFLPVLQWLPKYDLKKNILGDMMSGLIVG
ILLVPQSIAYSLLAGQEPIYGLYTSFFASLIYFILGTSRHISVGIFGILCLMIGEVVDRE
LYIAGYDTVHAASNESSLVNQMSNQTCDRSCYAITVGSTVTFVAGVYQVAMGFFQVGFVS
VYLSDALLGGFVTGASFTILTSQVKYLLGLSLPRSGGVGSLITTWIHIFRNIHKTNICDL
ITSLLCLLVLLPTKELNERFKSKLKAPIPVELFVVVAATLASHFGKLSEKYGTSIAGHIP
TGFMPPKAPDWNLIPRVAVDAIAIAIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCN
IIPSFFHSFTTSAALAKTLVKESTGCQTQVSGVMTALVLLLVLLVIAPLFFSLQKSVLGV
ITIVNLRGALCKFKDLPQMWRISRMDTVIWFVTMLSSALISTEIGLLTGVCFSMFCVILR
TQKPKASLLGLVEDSEVFESMSAYKNLQAKSGIKIFRFVAPLYYVNKEYFKSVLYKKTLN
PVLVKAAQRKAAKKKIKRETVTLSGIQDEVSVQLSYDPLEFHTIVIDCSAIQFLDTAGIH
TLKEVRRDYEAIGIQVLLAQCNPSVRDSLARGEYCKKDEENLLFYSVYEAMTFAEDSQNQ
KERYVPNGPSFSSD
Download sequence
Identical sequences Q9GJY3
ENSOARP00000006575 NP_001153228.1.54773 NP_001153228.1.66739 XP_012032939.1.66739 XP_012032941.1.66739 XP_012032942.1.66739 XP_012032943.1.66739 XP_012032944.1.66739 XP_012032945.1.66739 XP_012032946.1.66739 XP_012032948.1.66739 XP_012032949.1.66739 XP_012032950.1.66739 XP_014950958.1.66739 XP_014950959.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]