SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007160 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007160
Domain Number 1 Region: 335-511
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-54
Family Regulator of G-protein signaling, RGS 0.0000000305
Further Details:      
 
Domain Number 2 Region: 726-942
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-49
Family DBL homology domain (DH-domain) 0.00000000434
Further Details:      
 
Domain Number 3 Region: 945-1079
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-43
Family Pleckstrin-homology domain (PH domain) 0.000000286
Further Details:      
 
Domain Number 4 Region: 32-118
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-21
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007160   Gene: ENSOARG00000006679   Transcript: ENSOART00000007268
Sequence length 1535
Comment pep:known_by_projection chromosome:Oar_v3.1:1:105453981:105499911:-1 gene:ENSOARG00000006679 transcript:ENSOART00000007268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFSYSFSRLSSLSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFTVSG
DRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSS
PSSVGVSGPQQDPAPAGAPPPLPPPQRITGPRPLQDPEFQKHATQILRNMLRQEEKELQR
ICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDILPVYGDASQRSSEGRLSLD
SQEGDSGLDSGTERFPSLSESLANRNSVLSDAGLDSPRTSPVTVARLAQRHRRQGSDAPV
PPSTDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDFEKLKSRPAHLGVFLRYIFSQA
DPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKVPEMLQAEIDLRLRSSE
DVRAALCEAQEAAVPEIQEQIHDYRTKRTLGLGSLYGENDLLELDGDPLRERQVAEKQLA
ALGDILSKYEEDRSGPMGFALNTYMSHAGIRLRETRPPNTAEKAQSAPDKDKWLPFFPKT
KKQSSNSKKDKDALEDKKRNPILKYIGKPKTSSQSIKPGNVRNIIQHFENNQQYDAPEPG
TQRLSTGSFPEDLLESNSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAG
AQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPNLGFGTDALLPNLLEDDLGQLSDLE
PEPDAQNWQHTVGKDVVARLSQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKEG
LLPREELARLFPNLPMRKLREEGPIIKEVSDLMLARFDGPAREELQEVAAQFCSYQSVAL
ELIKTRQRKESRFQLFMQEAESHPQCRRLQLRDLIVSEMQRLTKYPLLLESICVLTAGGT
SEYEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDTTSLERASNPLAAEFKSLD
LTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKMAVGSSDSKQ
TFSPVLKLNAVLVRSVATDKRAFFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRN
ATRLPGAAPTPIHPPPPGPQEPARCSPDSSRAGPDDSEVFRGEAEPEAAPGGMGCPQRVQ
GKHSALLADAEQEGSVEEEELGALPHSSASLDSEPRGSRTRDPILLPLPGPLFMEGLADA
ALEDVENLRHLILWSLLPGHPTDPRAAGEPEDDLTPTPSINSITSHPWDPGSPGRAPTGA
EGDKAPLSGPEWSQPGQEDMALRSLEQLPPRTRNSGIWESSELDKNPEEEASSTEGTGSY
KVVRKGKVSALPGGGVGAAEVAGSKVVPALPESGPSGPEPPEAEGGAKAGTGNCFYVSMP
AGPPDSSTDLSGAHTSPSQPDGLPAWQTEPQPPLQGGHGDQKRPSRSPPSLALRDVGMIF
RTIEQLTLKLNRLKDMELAHRELLRSLGAQSSGGTTPVGSFHTEAARWIESSLSPPAKEP
PASDSTDSRDLGPCPEDGPTPMEDGTADTATSAGP
Download sequence
Identical sequences W5P9Q1
ENSOARP00000007160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]