SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007380 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007380
Domain Number 1 Region: 1191-1389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.43e-38
Family Pentraxin (pentaxin) 0.00059
Further Details:      
 
Domain Number 2 Region: 1553-1622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-19
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 3 Region: 3005-3074
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.56e-19
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 4 Region: 2597-2666
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.32e-18
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 5 Region: 1910-1979
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-18
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 6 Region: 1611-1680
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.2e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 2145-2215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.32e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 2539-2608
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 1727-1795
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 10 Region: 2481-2550
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 11 Region: 2655-2724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1454-1512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.00052
Further Details:      
 
Domain Number 13 Region: 2320-2387
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 14 Region: 1669-1736
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 15 Region: 2029-2097
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000118
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 3063-3130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000121
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 17 Region: 2829-2892
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000139
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 18 Region: 2204-2273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2438-2492
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 20 Region: 3182-3241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 21 Region: 2262-2325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000389
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 22 Region: 985-1116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000612
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 23 Region: 204-270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 24 Region: 1393-1465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000876
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 25 Region: 2713-2780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000876
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 26 Region: 2088-2156
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000931
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 27 Region: 2887-2950
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000106
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 28 Region: 1970-2034
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000114
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 29 Region: 2773-2838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000114
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 3123-3191
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000132
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 31 Region: 1784-1852
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000278
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 143-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000347
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 33 Region: 1848-1921
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000931
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 34 Region: 1149-1188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000471
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 35 Region: 753-897
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000879
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 36 Region: 2947-3010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000012
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 37 Region: 1111-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 38 Region: 960-997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000265
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 39 Region: 1507-1550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family EGF-type module 0.033
Further Details:      
 
Domain Number 40 Region: 263-321
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000153
Family Complement control module/SCR domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000007380
Domain Number - Region: 3233-3270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000135
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 44-184,230-247
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000157
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 3272-3301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000714
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 494-554
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000989
Family Complement control module/SCR domain 0.0067
Further Details:      
 
Domain Number - Region: 3301-3332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0012
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007380   Gene: ENSOARG00000006857   Transcript: ENSOART00000007491
Sequence length 3337
Comment pep:known_by_projection chromosome:Oar_v3.1:2:12765657:12930533:1 gene:ENSOARG00000006857 transcript:ENSOART00000007491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIPKEEHCYLLHSFEEFEALARRALHEDLPSGSFIQEDMSHCSYLCEAGKDCCDQMAS
CKCGTHTGQFECICEKGYYGKGLQYECTACPSGTYKPEGSPGGISTCLPCPDENHTSPPG
STSLEDCVCKEGYQASGQTCKVVHCPALKPPENGYFIRNTCNNHFNAACGVRCHPGFDLV
GSSIFLCLPNGLWSSSESSCRVRTCPRLRQPKHGRLSCSAGEMSYRTVCLVTCDEGYRLE
GSARLTCQVNAQWDGPEPRCVERHCATFQKPKGVTVSPPNCGRHPAKPGTICQLSCRQGF
ILSGAREEVRCTTSGKWSTKVQTAACKDVEAPQIICPADIEAETQEQQDSANITWQIPTA
KDNSGEKVSIHVHPAFSPPYLFPIGDVAVTYTATDPSSNQASCTFHIKVIDVEPPSIDWC
RSPPPVQVSEKEHAVTWDEPQFSDNSGAVVTVTRSHTPGDLFPQGETVVRYTATDPSGNN
RTCDIHIVVKGSPCEVPFTPVNGDFVCTQDSTGVNCTLSCLEGYDFTEGSTDKYYCAYED
GIWKPPYSTEWPDCAIKRFANHGYKSFEMLYKATRCDDTDLLKKFSEAFETTLGKMVPSF
CSDADDIDCRLEDLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYGDFQDTVRETPTG
AGKARSSRIERSAPISDHKIRLIFNITASVPLPDERNDTLELENQQRLIKTLETITNQLK
RTLAKEPMYSFQLASEMLVVDSNSLETEKAFLFCRPGSVLRGRMCVNCPLGTYYSLEHSV
CESCLMGSYQDEEGQLECKPCPTGTYTEYLHSRSSSECKAQCKQGTYSSNGLETCESCPL
GSYQPAFGSRGCLLCPENTSTVKRGAADISACGVPCPVGEFSRSGLMPCYPCPQDYYQPN
PGKSFCLSCPFYGTTAITGARSITDCSSFSSTFSAAEESTVLHSPPGHVKKKYEVSSQVF
HECFLNPCHNSGTCQQLGHGYVCLCLPGYTGLKCEIDIDECSSLPCHNNGICKDRVGEFI
CECPSGYTGQLCEENVNECSSSPCLNKGTCVDGLAGYHCTCVKGYMGLHCETEVNECQSS
PCLNNAVCEDQLGGFLCKCPPGFLGTRCDINMDECLSQPCKNGATCKDGANSFRCQCAAG
FTGTHCELNVNECQSNPCKNQATCVDELNSYSCKCQPGFSGSRCETEQSAGFNLDFEVSG
IYGYVMLDGVLPSLHAVTCAFWMKSSDDINYGTPISYALENGSDNTFLLTDYNGWVLYVN
GKEKITDCPSVNDGNWHHIAITWTSTGGAWKVYIDGKLSDGGMGLSIGSPIPGGGALVIG
QEQDEKGEGFNPAESFVGSISQLNLWDYVLSPQQVNSLATSCPEELSKGNVLAWPDFLSG
IVGRVKINPKSIFCSDCPSLEGSVPHLRTASRDVKPGSKISLFCDPGFQMVGNSVQYCLN
QGQWTQPLPRCERISCGVPPPLEHGFYSAEDFHAGSTVTYQCNNGYYLLGDSRMFCTDNG
SWNGISPSCLDVDECAVGSDCSEHASCLNTNGSYVCSCIPPYTGDGKNCAEPIKCKTPGN
PENGHSSGETYTVGAEVTFSCEEGYQLVGVARITCLESGEWSHLIPYCEAVSCGAPALPE
NGGVDGSAFTYGNKVIYRCNKGYTLEGEKESSCLASGSWSHSPPVCELVKCSSPEDVNHG
NYILSGLTYLSTASYSCDNGYSLQGPSVIECSASGSWDRAPPTCHLVSCGEPPAIKDAVT
TGSNFTFGNTVTYACREGYTLAGPDTIECLASGKWSRSDQQCLAVSCDEPPSVEHASPET
AHRLFGDIAFYYCSDGYSLADNSQLLCNAQGKWVPPEGQAMPRCIAHFCEKPPAVSYSIL
ESVSKAKFAAGSVVSFKCMEGFVLNTSAKIECLRGGQWSPSPMSIQCIPVRCGEPPRIMN
GYAIGSNYSFGAMVAYSCNRGFYIKGEKKSACEATGQWSSPTPTCHPVSCSEPPKVENGF
LEHTTGRTFESEVRYQCNPGYKSVGSPVFVCQANRHWHSESPLSCIPLNCGKPPPIQNGY
IKGENFEVGAKVHFFCNEGYELIGDHSWTCLKSGKWSKKPNQKCVPAKCPEPPLLENQLV
LKELTTEVGVVTFSCKEGHVLQGRSVLRCLPSQQWNDSFPVCKMVLCRPPPLISFGVPAP
SSALHFGSTVKYSCVDGFFLKGDPTTSCQADGTWSSPLPECVPVECPQPEEILNGIIDVQ
GLAYLSTALYTCKPGFELVGNTTTLCGENGHWLGKKPTCKPIECSKPKEILNGKFSYTKL
HYGQTITYSCDQGFRLEGPKALTCLETGDWDVDVPSCNAIHCDPPQPIENGFVEGADYSY
GAMIIYSCFPGFQVAGHTMQTCEESGWSSSIPTCVPIDCGLPPHIDFGDSTVVRDGQGYF
NQEDDMMEVPHVTPHPPHHLGTVAKIWGNTKGSPAMHSAKFRYNTLVSYSCNPGYELLGN
AVLICQEDGTWNGSAPSCISIECDLPVAPENGFLHVTETTTGSAVQYSCKPGHTLVGSDI
RLCLRNREWSGASPRCEVISCPKPNPVTDGSIQGSTYSYLSVLYYECNSGYVLNGTSRRT
CQEDKTWDGDEPVCIPVDCGSPPSSANGQIKGEEYTFQKEVQYTCNTGFLLEGASSRVCL
ADGSWSGNTPTCVPVRCAPPSQVENGVMDGLDYGFGKEVVFHCQDGYALHGAPKLTCQSD
GNWDAQVPVCKPVNCSPPEDLDRGFPNGFSFYRGGQIEYQCFPGYKLHGSPSRKCLSNSS
WSGSPPSCLPCKCSPPTIQSGAVNGTDVSCGKAAQIRCFKGFQLLGLSEITCEADGQWSS
DFPRCEHLSCGSPPTIPNAFIIERGSLEENVITYACKPGYVIQGSSDLICTEKGTWSQPY
PVCEPLSCGPPPSVSNAVATGESYTYESQVKLRCLEGYMMDTDIDTFTCQKDGRWVPELI
SCSPKKCPLPTNVTHILVHGDDFSVNKQVSVSCAEGYTYEGVNISTCQLDGTWEPPFSDE
SCSPISCGKPESPEHGFVFGSEYNFESTITYHCETGYELEGNRERVCQENGQWTGEVATC
KKIMCEAPLEFLNGKAEVENSTTGPSVIYSCNRGYSLEGAPEASCTENGTWSHPVPLCKP
NPCPVPFVIPENAVLSEKEFYVDQNVSIKCREGFLLRGQSTITCNPDETWTQTSAKCEKI
SCGPPTHVENAIARGVHYQYGDMITYSCYSGYMLEGSLRSVCLENGTWTSPPVCRAVCRF
PCQNGGICQRPNACSCPDGWMGRLCEEPICILPCLNGGRCVAPYQCDCSPGWTGSRCHTA
VCQSPCLNGGKCVRPNRCHCLSAWTGHDCSRKRRTGF
Download sequence
Identical sequences W5PAC1
ENSOARP00000007380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]