SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007499 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007499
Domain Number 1 Region: 4-168
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 6.02e-29
Family ENV polyprotein, receptor-binding domain 0.00064
Further Details:      
 
Domain Number 2 Region: 423-476
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00000000000000145
Family Virus ectodomain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007499   Gene: ENSOARG00000006999   Transcript: ENSOART00000007611
Sequence length 476
Comment pep:novel chromosome:Oar_v3.1:1:106740723:106742165:1 gene:ENSOARG00000006999 transcript:ENSOART00000007611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMNPHQPVKITWKLQNGLTREMLNSTTAIHPPNTWWPDLYFDLKPVVNVPWKRGKLRNHA
FWACPDAPRHNWKICGGIQDSYCKSWDCVTSNDGSETPGYRRWDVGNQDLFNFSFVGPVP
PYSNWEKDHNFAQVKIRFNIDKAKKEKAWVNGRSWGLQTRTDGFPYREYYNEIIVVSQVL
EPVQMYSIGPNPIEQVHATLYPTTSLPTSQGPTKDPEVGPLAKLGQTDPLWESVKAAYAT
LNQTHPEATKSCWLCYNLIPPYYEAVGLNASYNLTNGTDPPQCRWGLTMREVWGKGLCMG
KVLSERSPLCAHVVEPTDLPIARWLIPRMGGWWVCSHTGLTPCLHSSIFDPKKEFCVMVA
VIPKILYRPEEAVYDYWAHKLTLNQQERAYKVKREPITAITIATMFGLGIAGAGTGIAAL
SMQSQGFNSLRAAIDEDITRIEQSISHLESSLTSLSEVVLQNRRGLDLLFLQQGGL
Download sequence
Identical sequences W5PAN8
ENSOARP00000007499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]