SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007673 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007673
Domain Number 1 Region: 11-185
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-42
Family RUN domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000007673
Domain Number - Region: 256-297
Classification Level Classification E-value
Superfamily eIF1-like 0.0288
Family eIF1-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007673   Gene: ENSOARG00000007156   Transcript: ENSOART00000007788
Sequence length 375
Comment pep:known_by_projection chromosome:Oar_v3.1:24:10676205:10970881:1 gene:ENSOARG00000007156 transcript:ENSOART00000007788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTQNNDMKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKR
SRGLALTAAAIKQAAGFASKTETEPVFWFYVKEVLSKHELQRFYALRHIASDVGRGRAWL
RCALNENSLERYLHMLLADRGRLSTFYEDWAFVMDEERSSMLPTMAAGLNSILFAINIDN
KDLNGQSKFAPTVSDLLKESTQNVTSLLKESTQGVSSLFREITASSAVSILSRAEQETDP
LPVVSKHVGADARCKRERKKKKKVTNIISFDDEEDEQSSGDVFKKIPAAGESSEENSDRS
SINILSAFESPFGPNSNGSQGSNSWKIDSLSLNGEFGYQKLDVKSIDDEDADENEEDVYG
SMPGRKRPGHLESPE
Download sequence
Identical sequences W5PB62
ENSOARP00000007673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]