SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007885 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007885
Domain Number 1 Region: 2978-3236
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-57
Family YWTD domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 1238-1503
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 1553-1810
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-44
Family YWTD domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 3858-4132
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-44
Family YWTD domain 0.00000531
Further Details:      
 
Domain Number 5 Region: 1861-2100
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-41
Family YWTD domain 0.0000167
Further Details:      
 
Domain Number 6 Region: 510-748
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-41
Family YWTD domain 0.00000905
Further Details:      
 
Domain Number 7 Region: 174-438
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-38
Family YWTD domain 0.0000738
Further Details:      
 
Domain Number 8 Region: 2192-2413
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-33
Family YWTD domain 0.0000493
Further Details:      
 
Domain Number 9 Region: 3561-3599
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 10 Region: 834-876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000628
Family LDL receptor-like module 0.0000933
Further Details:      
 
Domain Number 11 Region: 915-954
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 12 Region: 960-998
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 3643-3688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 14 Region: 3602-3638
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 15 Region: 3318-3358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 1000-1038
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.000088
Further Details:      
 
Domain Number 17 Region: 875-917
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 18 Region: 3437-3477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 19 Region: 1-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 20 Region: 3484-3522
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000111
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 21 Region: 1043-1083
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 22 Region: 2682-2718
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 3400-3435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 24 Region: 2766-2802
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3360-3398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 26 Region: 2724-2758
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000113
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 27 Region: 116-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.004
Further Details:      
 
Domain Number 28 Region: 2854-2889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 3281-3316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 30 Region: 3731-3766
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 31 Region: 2899-2937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000758
Family EGF-type module 0.021
Further Details:      
 
Domain Number 32 Region: 1815-1865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000011
Family EGF-type module 0.012
Further Details:      
 
Domain Number 33 Region: 2931-2972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000132
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 34 Region: 2482-2519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 35 Region: 45-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 36 Region: 1129-1164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 37 Region: 1089-1127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 38 Region: 2610-2641
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000101
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 39 Region: 3685-3721
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 40 Region: 797-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family EGF-type module 0.017
Further Details:      
 
Domain Number 41 Region: 2120-2167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000605
Family EGF-type module 0.01
Further Details:      
 
Domain Number 42 Region: 4184-4219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000081
Family EGF-type module 0.042
Further Details:      
 
Domain Number 43 Region: 1514-1565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000943
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000007885
Domain Number - Region: 3247-3297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000351
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 460-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000671
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4257-4292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000691
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 4221-4258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 3812-3847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00114
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 2532-2556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00118
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 1201-1236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0014
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 91-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0043
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 2563-2592
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00746
Family LDL receptor-like module 0.0047
Further Details:      
 
Domain Number - Region: 4363-4399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 4140-4172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0686
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4295-4328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.082
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007885   Gene: ENSOARG00000007332   Transcript: ENSOART00000008002
Sequence length 4526
Comment pep:known_by_projection chromosome:Oar_v3.1:3:162124659:162196045:-1 gene:ENSOARG00000007332 transcript:ENSOART00000008002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCI
LMSRLCNGVQDCADGSDEGPHCREQRGQCSHLGCQHHCVPTLNGPACYCNTSFQLQADGK
TCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANS
QNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKG
FVDEYTINISLSLHHVEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDTCVTLLDLELYNPK
GIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLDLVSRLVYWADA
YLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFENYLYATNSDNANAQQKTSVIRVNRFN
STDYQVVTRVDKGGALHIYHQRRQPRVRSHACENDQYGKPGGCSDICLLANSHKARTCRC
RSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMNPRALDF
HAETGFIYFADTTSYLIGRQKIDGTERETILKDGIHNVEGVAVDWMGDNLYWTDDGPKKT
ISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAWMDG
SHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPELNHAF
GLCHHGNYLFWTEYRSGSVYRLERGTGGAAPIVTLLRSERPPIFEIRMYDAQQQQVGTNK
CRVNNGGRRRPAPAAPRGACPSLCLATPGSRQCACAEDQVLDADGVTCLANPSYVPPPQC
QPGEFACSNSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCENNRCIPNRWLC
DGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYP
TCFPLTQFTCNNGRCININWRCDNEKDCGDGSDEKTCPHSCSSTQFKCNSGRCIPEHWTC
DGDNDCGDYSDETHANCTNQATRPPGGCHSDEFQCRLDGLCIPLRWRCDGDTDCMDSSDE
KSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCESLACRPPSHPCAN
NTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCLGMELGPDNHTCQIQSYCAKHL
KCSQKCDQNKFSVKCSCYEGWVLEPDGESCRSLDPFKPFIIFSNRHEIRRIDLHKGDYSV
LVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNGALTSFEVVIQYGLATPEGLAV
DWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDGILFWTDWDASLP
RIEAASMSGAGRRTIHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYSARYDGSGHMEV
LRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQVYHPS
RQPMAPNPCEANGGRGPCSHLCLIDYNRTVSCACPHLMKLHKDNTTCYEFKKFLLYARQM
EIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFINGTGVET
VVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNAVVQGLEQPHGLVVHP
LRGKLYWTDGDNISMANMDGSNRTLLFSGQRGPVGLAIDFPESKLYWISSKNHTINRCNL
DGSELEVIDTMRNQLGKATALAIMGDKLWWADQVSEKMGTCNKADGSGSVVLRNSTTLVM
HMKVYDESIQLDHEGTNPCSVNNGDCSQLCLPTSETTRSCMCTAGYSLRSGQQACEGVGS
FLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISRAKR
DQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGLDKPR
GITLHPRYLFWTEWGQYPRIERSRLDGSERVVLVNVSISWPNGISVDYQDGKLYWCDART
DKIERIDLETGEDREVVLSSNNMDMFSVSVFEEFIYWSDRTHANGSIKRGSKDNATDSVP
LGIGVQLKDIKVFNRDRQKGTNVCAVDNGGGPQLCLYRGNGQRACACAHGMLAEDGASCR
EYAGYLLYSERTILKSVHLSDERNLNAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRI
FFSDIHFGNIQQINDDGSGRTTIVENVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQT
RPGAFERETVITMSGDDHPRAFVLDECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKD
IRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSRRYVILKSEPVHPFGLAVYGEHIFWT
DWVRRAVQRANKYVRVDIPQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQCHVN
CSCRGGRKLPDDFTCTAVNSSCRAQDEFECANGECINFGLTCDGVSHCKDKSDEKPSYCT
NTPRRHETLRHLSNMLWCNGADDCGDGSDEIPCNKTACGVGERCRAAPGFGTSSRCNQFV
DCEDASDEMNCSATDCSSYFRLGVKGVRFQPCERTSLCYAPSWVCDGANDCGDYSDERDC
PGVKRPRCPLNYFACPSTRRMTVNTPLIPSQSNCDLYPTAPDKFCSEAQFECQNHRCISK
QWLCDGSDDCGDGSDEAAHCEGKTCGPNSFSCPGTHVCVPERWLCDGDKDCADGADESVA
AGCLYNSTCDDREFMCQNRQCIPKHFMCDHDRDCADGSDESPECGLPGPGHLPLPKGHPS
PCPQLSWEGGPSPQAARDPADSPPPPHPPEHKCNASSQFLCSSGRCVAEALLCNGQDDCG
DSSDERGCHVNECLSHKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFP
CSQRCINTHGSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTL
LKQGLNNAVALDFDYREQMIYWTDVTTQGSMIRRMHLNGSDVQVLHRTGLSNPDGLAVDW
VGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIG
RIGMDGSSRSVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDI
PHIFALTLFEDYVYWTDWETKSINRAHKTTGANKTLLISTLHRPMDLHVFHALRQPDEPR
FPRQGKNSSCSNLCLLSPGGGHKCACPTNFYLGGDGRNCVSNCTASQFVCKNDKCIPFWW
KCDTEDDCGDHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIH
VCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVW
VCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEEC
DERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCSMSPPHPRPPAHRCPGCRDKG
HCSARAGDALEAESLCPPSWAPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCT
PRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQCNNTLCKPLA
WKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEED
CEPPTTQTSHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSMDPKLTSCATNAS
ICGDEARCVRTEKAAWAKPPRRETLPDSRAYINECLRFGTCSQLCNNTKGGHLCSCARNF
MKTHNTCKAEGSEYQVLYIADDNEIRSLFPSHPHSAYEQAFQGDESVRIDAMDVHVKAGR
VYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVY
WTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDG
TLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPF
SIDVFEDYIYGVTYINNRVFKIHKFGHSPLINLTGGLSHASDVVLYHQHKQPEVTNPCDR
KKCEWLCLLSPSGPVCTCPNGKRLDNGTCVAVPSPTPPPDAPRPGTCNLQCFNGGSCFLN
ARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCA
GYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAY
FEGPRCEVNKCSRCLDGACVVNKQSGDVTCNCSDGRVAPSCLTCVGHCSNGGSCTMNNKM
MPECQCPPHMAGPRCEEQVVGQKQPGHMASILIPLLLLLLMLLVAGVVFWYKRRVRGAKG
FQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKEQRAVGGATKCVGLD
DGMNGAVALQPTNFTNPVYATLYMGG
Download sequence
Identical sequences W5PBS4
ENSOARP00000007885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]