SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007943 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007943
Domain Number 1 Region: 111-183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.07e-17
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 2 Region: 173-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.37e-16
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 3 Region: 429-492
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000418
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 234-299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 5 Region: 50-116
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000688
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 487-545
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000292
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 7 Region: 315-371
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000148
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 8 Region: 367-433
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000432
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007943   Gene: ENSOARG00000007405   Transcript: ENSOART00000008060
Sequence length 608
Comment pep:known_by_projection chromosome:Oar_v3.1:12:4210173:4266689:1 gene:ENSOARG00000007405 transcript:ENSOART00000008060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHQRVPVMILHSKGTMASWPFSRLWSISDPILFQVTLVATLLATVLGSCGIPPYLDFAY
PINELNETTFETGTTLRYKCRPGYTMSSKSYFLICKATGNWNYREFCVKKRCGNPGELLN
GQVIVKTDYSFGSEIEFSCSEGYILIGSANSYCEIQDKGVGWSDPLPQCLIAKCKPPPTI
SNGRHNGGDEDFYTFGSSVTYSCDPDFSMLGKASISCRVQNKTIGVWSPSPPSCKKVICV
QPVVKDGKITSGFGPIYTYQQSIVYACNKGFRLEGSNVIRCEADNSWSPPPPTCELNGCV
GLPHIPHASWGRYGYQTQTKHEVYDIGTVLSYNCHFGYKPEADGPRTVTCQSNLKWSPYI
ECKEVCCPVPNLNNDGSITLRRRLSNSTHCIYFSGDEISYECHNKYRLDATCTKYGTWNP
RTPECSPDCESPPVIAHGRHKIVSKGSWYQHEEVEYECDEGYILDGAKRLSCTSSGWSPA
VPQCKARCVKPEIEYGKLSVEKVRYVEPERITIQCESGYSLVGSENITCSEDRTWYPEAP
KCEWEYPEGCEQVITGRKLLQCLPRPEEVKLALEVYKLSLEIELLHTEKLKKSSEREGEK
CTCAFNPK
Download sequence
Identical sequences W5PBY2
ENSOARP00000007943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]