SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007944 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007944
Domain Number 1 Region: 542-791,832-945
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.88e-130
Family Oxysterol-binding protein 0.0004
Further Details:      
 
Domain Number 2 Region: 9-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-42
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 237-346
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000545
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007944   Gene: ENSOARG00000007396   Transcript: ENSOART00000008061
Sequence length 953
Comment pep:known_by_projection chromosome:Oar_v3.1:23:32622459:32832245:1 gene:ENSOARG00000007396 transcript:ENSOART00000008061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTDAEQQLLHHARNGNAEEVRQLLETMERNEVIADINCKGRSKSNLGWTPLHLACYFGH
RQVVQDLLKAGAEVNVLNDMGDTPLHRAAFTGRKELVMLLLEHNADTTVVNGNGQTAKEV
THDKEIRNMLEAVERTQQRKLEELLLAAAREGRTAELTALLNRPNPPDVNCSDQLGNTPL
HCAAYRAHKQCALKLLKSGADPNLKNKNDQKPLDLAQGAEMKHVLVGNKIIHKALKRYEG
PLWKSSRFFGWRLFWVVLEHGVLSWYRKQPDAVHNAYRQGCKHLTQAVCTVKSTDSCLFF
IKCFDDTVHSFRVPKNSLQQTREDWLEAIEEHSAYSTHYCSQDQVTDDEEDDAVSAVDLK
ESLEKAQICQQRLDRDISNFLKMIKECDMAQEMLPSFIQKVEVVAEASRETCVALSDCLH
LFTKQEGVRNFKLEQEQEKNKILSEALATLATEHHELEQSLVKGSPPLSIFSEDEFYDAL
SDSESEGSLSRLEAVTAHSFDEEAEAPSSRQHRMSEGKDCGGGDALSNGIKKHRTSLPSP
MFSRNDFSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLADPV
ERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVRILRDDLGFRLISEQVSHHPPISA
FHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHNEAYTWTNPTCCVHNIIV
GKLWIEQYGNVEITNHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTE
CLYSVDPATFDAYKKNDKKNTEEKKNSKQVSASEESDEMPMPDSESVFVIPGSVLLWRIA
PRPPNSAQMYNFTSFAMVLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLE
EKQRAARKNRSKSEEDWKTRWFHQGPNPYSGAQDWLYSGSYWDRNYFNLPDIY
Download sequence
Identical sequences W5PBY3
ENSOARP00000007944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]