SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008107 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008107
Domain Number 1 Region: 245-345
Classification Level Classification E-value
Superfamily HMG-box 1.15e-23
Family HMG-box 0.00000161
Further Details:      
 
Domain Number 2 Region: 512-610
Classification Level Classification E-value
Superfamily HMG-box 3.14e-22
Family HMG-box 0.00000548
Further Details:      
 
Domain Number 3 Region: 103-185
Classification Level Classification E-value
Superfamily HMG-box 2.09e-21
Family HMG-box 0.00000347
Further Details:      
 
Domain Number 4 Region: 360-433
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000851
Family HMG-box 0.0000295
Further Details:      
 
Domain Number 5 Region: 437-515
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000107
Family HMG-box 0.00000748
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000008107
Domain Number - Region: 637-655
Classification Level Classification E-value
Superfamily ARM repeat 0.015
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008107   Gene: ENSOARG00000007557   Transcript: ENSOART00000008228
Sequence length 721
Comment pep:known_by_projection chromosome:Oar_v3.1:11:43444385:43455249:-1 gene:ENSOARG00000007557 transcript:ENSOART00000008228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNIPSNDSSKFKTTESHMDWEKVAF
KDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYF
RFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
EDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDEIMRDYIQKHPELNISEEGI
TKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQ
KEKDAYHKKCDQKKKDYEVDLLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPSQ
DAGKGGSEKPKRRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKY
KAREAALKAQSERKPGKLPESPKRAEEIWQQSVIGDYLARFKNDREKALKAMEMTWNNME
KKEKLMWIKKAAEDQKRYERELSERRAPPAAANSSKKMKFQGEPKKPPMNGYQKFSQELL
SNGQLNHLPLKERMVEIGSRWHRISQSQKEHYKKQAEEQQKQYKVNLDLWVKSLSPQERA
AYKEYISNKRKNMTKLRGPNPKSSRTALQSKSESEDDDEEDEDEDEEDEEEEDDENGDSS
EDGGDSSESSSEDESEDGDENEEDDEDEDDDEDDDEDEDNESEGSSSSSSSSGDSSDSDS
N
Download sequence
Identical sequences W5PCE5
ENSOARP00000008107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]