SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008458 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008458
Domain Number 1 Region: 30-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 87-145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008458   Gene: ENSOARG00000007885   Transcript: ENSOART00000008581
Sequence length 199
Comment pep:novel chromosome:Oar_v3.1:12:4470318:4477430:1 gene:ENSOARG00000007885 transcript:ENSOART00000008581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPVSGRKSPVLYLHGILTVLLCPDSLQGCSAPPEVKHGHFTYIEREIFGTDVVEYECQE
GYTLVGEARISCTFFNWSPPAPQCKAVCQNPEISNGKLSVEKDQYVTPETVTIRCNTGYR
MVGSQNIFCSENKSWSPDVPKCEKVPVELCEAVLKGQKLLKCLPNAWEAKVALELHKLSL
EIEKLEQEKRKKIHAQERS
Download sequence
Identical sequences W5PDE5
ENSOARP00000008458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]