SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008519 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008519
Domain Number 1 Region: 26-189
Classification Level Classification E-value
Superfamily RUN domain-like 4.84e-45
Family RUN domain 0.0000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008519   Gene: ENSOARG00000007936   Transcript: ENSOART00000008643
Sequence length 384
Comment pep:known_by_projection chromosome:Oar_v3.1:11:43536255:43545333:1 gene:ENSOARG00000007936 transcript:ENSOART00000008643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASFVQTTMALGLSSKKASSRNVAVERRNLITVCRFSVKTLLEKYTTEPIDDSSEEFVN
FAAILEQILSHRFKAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAK
GRAWIRVALMEKRMSEYITTALRDTRTTRRFYDSGAIMMREEATVLTGMLIGLSAIDFSF
CLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAEAESRRLQLQLEEAAAQNQRE
KRELEGVILELQEQLTGLIPGDHAPLAQGSKDLTTRLVNQWPSLGTLSGAEGANNPKLYR
RHSFMSTEPLSAEASLSSDSQRLGEGKRDEEPWGPIGEPPNPPSMLGLCGSLASIPSCKS
LASFKSNECLVSDSPEGSPALSDA
Download sequence
Identical sequences W5PDK6
ENSOARP00000008519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]