SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009527 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009527
Domain Number 1 Region: 1-158,196-259
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.98e-68
Family BAR domain 0.00071
Further Details:      
 
Domain Number 2 Region: 252-282,310-367
Classification Level Classification E-value
Superfamily SH3-domain 5.8e-17
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009527   Gene: ENSOARG00000008873   Transcript: ENSOART00000009664
Sequence length 368
Comment pep:known_by_projection chromosome:Oar_v3.1:3:7372330:7385942:1 gene:ENSOARG00000008873 transcript:ENSOART00000009664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFTEEKFGQAEKTELDAHFESLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKL
DRKVPSRVTNGELLAQYMAEAASELGPTTPYGKTLIKVAEAEKRLGAAERDFIHTASINF
LTPLRNFLEGDWKTISKERRLLQNRRLDLDASKARLKKAKAAEAKATTVPDFQETRPRNY
ILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVESQ
TTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPSPPPPAAATMPMGPSVADLAPPGEAALRL
EEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVP
VTYLELLS
Download sequence
Identical sequences W5PGG1
ENSOARP00000009527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]