SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010264 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010264
Domain Number 1 Region: 128-270
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-27
Family Cadherin 0.0000453
Further Details:      
 
Domain Number 2 Region: 361-487
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-26
Family Cadherin 0.0003
Further Details:      
 
Domain Number 3 Region: 252-368
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-18
Family Cadherin 0.00022
Further Details:      
 
Domain Number 4 Region: 474-578
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 41-140
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000628
Family Cadherin 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000010264
Domain Number - Region: 19-52
Classification Level Classification E-value
Superfamily Cadherin-like 0.0612
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010264   Gene: ENSOARG00000009566   Transcript: ENSOART00000010416
Sequence length 608
Comment pep:known_by_projection chromosome:Oar_v3.1:14:8805141:9619968:1 gene:ENSOARG00000009566 transcript:ENSOART00000010416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVIVGGKDIQGSLQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDS
DRPEGSKFRLTGKGVDQEPKGIFRINENTGSVSVTRNLDRETIATYQLFVETVDVNGRTL
EGPVPLEVIVIDQNDNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYN
IRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTG
TATATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIING
NPGQSFEIHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVH
ITVLDVNESPVFYPDPMMVTKQENISVGSVLLTVNATDPDSLQRQTIRYSVYKDPAGWLN
INPINGTVDTTAVLDRESPFVHNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFI
YPTVAEVCDDAKNLSVVILGATDKDLHPNTDPFKFEIHKQTVPDKVWKISKINNTHALVS
LLQNLNKANYHLPIMVTDSGKPPMTNITDLRVQVCSCKNSKVDCNAAGAPHFSAAAALLL
PLFSLARL
Download sequence
Identical sequences W5PIJ5
XP_011989027.1.54773 XP_011989028.1.54773 XP_012045005.1.66739 XP_012045006.1.66739 ENSOARP00000010264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]