SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010515 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010515
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 5.23e-24
Family ENV polyprotein, receptor-binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 422-461
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0000000000417
Family Virus ectodomain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010515   Gene: ENSOARG00000009805   Transcript: ENSOART00000010671
Sequence length 461
Comment pep:novel chromosome:Oar_v3.1:1:257850625:257852054:-1 gene:ENSOARG00000009805 transcript:ENSOART00000010671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SINPHQPVRITWKLQNGLTREMLNSTTAIHPPNTWWPDYFDIKPVVNVPWKRGKLQNHAF
WACPGAPRHNWKICGGIQDSYCKSWDCVTSNDGSETPGYRQWDVGNRDLLNFSFVGPIPP
YTIWEKDHNFAQVKTKPKKEKAWVNGISWGLQTRTDGFPYREYYNGIIVVSQVLEPVQMY
SIGPNPVEQVHATLYPTTSLPTSQGPTKDPEAGPLAKLGQTDPLWKLVKAAYATLNQTHP
EATKSCWLCYNLIPPYYEAVGLNASYDLANGTDPPQCQWGDRKVGLTMREVWGKGLCMGK
VLSERSPLCAHVVEPTDLPIARWLIPRMGGWWVCSHTGLTPCLHSSIFDPKVEFCVMVAV
VPTADYWAPKLTLNPQERTYKVKREPLTAITIATMFSLGIAGAGTGITALSLQSQGFNSL
RAIDEDITHIEQSISHLESSLTSLSEVVLQNRRGLDLLFLQ
Download sequence
Identical sequences W5PJ94
ENSOARP00000010515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]