SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010705 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010705
Domain Number 1 Region: 865-1045
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.41e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 1020-1133
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 160-192,228-374
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-30
Family Phosphotyrosine-binding domain (PTB) 0.0055
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-20
Family Phosphotyrosine-binding domain (PTB) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010705   Gene: ENSOARG00000009981   Transcript: ENSOART00000010862
Sequence length 1260
Comment pep:known_by_projection chromosome:Oar_v3.1:6:57171635:57399713:1 gene:ENSOARG00000009981 transcript:ENSOART00000010862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPFPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQSSKKEPG
TKPVRLCVSPSGLRCEPEPGKSQQWDPLICSSIFECKPQRVHKLIHNSHDPSYFACLIKN
DAANQQSICYVFKADDQTKVPEIISSIRQAGKIARQEELRCPSEFDDTFAKKFEVLFCGR
VAVAHRKAPPALIDECIEGFSHVSGGFSSDQFRSAPQPPGDGERGPRPMRKSFSQPGLRS
LAFRKEFQDAGLRSSSFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEVYLI
SPDTKKIALQKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALVDEI
MMTLKQAFTVAAVQQTAKAPAQLCEGCPLQSLHKLCERIEGMNSSKTKLELQKHLTTLTN
QEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKVHIHIGEIKQASQVAAENIGSE
LPSSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSASLDLDNSMSSMFSNTSK
EPSGCEKEALSTSESCFRLLGSSDDLSSDSESQPTEEPALLSPKQGFRRRANTLSHVPVE
CQEPPQLVRGSPGVSQRKLVRYHSVSTETPRERNGNCPPVGESQSPSGQSSAPASPPRLS
PSASSPNFFKYLKHNPSGEQSGSAVPKSISYRNALRKKLHSSSSVPNFLKFLAPVDENNT
SDFMNTQRDFESKADHINDANRTPVKTRRHSWRQQIFLRVATPQKACESPKRYEDYSELG
DLPPRSPLEPVCEDGPFGPVPEEKKRTSRELRELWQKAILQQILLLRMEKENQKLQASEN
DLLNKRLKLDYEEITPCLKEVTTVWEKILSTPGRSKIKFDMEKMHSAVGQGVPRHHRGEI
WKFLAEQYHLKHPFPCKQQPKDTPYKELLKQLTSQQHAILIDLGRTFPTHPYYSAQLGAG
QLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMGEEEAFNMLKFLMFDMGLRKQYRPD
MIILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTVFASQFPLGFVARVFDM
IFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKSTLPNLGLVQMEKTISQQVFET
DISKQLQAYEVEYHVLQEELIDSSPLSDNQRMDKLEKTNSSLRKQNLDLLEQLQVANGRI
QSLEATVEKLLTSESKLKQATLALELERSALLQTVEQLQRQMAELGSREADPTLPKPSGD
Download sequence
Identical sequences W5PJT4
ENSOARP00000010705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]