SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011027 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011027
Domain Number 1 Region: 58-263
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-48
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 307-491
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-40
Family BAR domain 0.0048
Further Details:      
 
Domain Number 3 Region: 544-631
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000002
Family SH3-domain 0.0000819
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011027   Gene: ENSOARG00000010289   Transcript: ENSOART00000011187
Sequence length 691
Comment pep:known_by_projection chromosome:Oar_v3.1:6:19650992:19793944:-1 gene:ENSOARG00000010289 transcript:ENSOART00000011187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLERRKTDTVVESSVPGDHSGTLRRSQSDRSEYNQKLQEKMTPQAGCSTAETLTQEDEHQ
IRRMMAKRAKIIKELIQTEKDYLNDLELCVREVVQPLRNKQVDRLDVDSLFSNIESVHQI
SAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPLEDIYKIYCYHHDEAHSVLESYEKEEEL
KQHLSLCIQSLKNIYMQQGKPNLLDMGSLMIKPIQRVMKYPLLLCELRNSTPSSHPDFQA
LEDAYAAVKHINVNINELKRRKDLVLKYKKNDEEESLKDKLSKLNIHSISKKSKRVTNHL
KILTRGESQVRDNTFDREEKLFRSLEKTVRHCVKNISFCLQHIQDAMPLALQSMMELQEI
SHNKDEEESSYSESPSNAPNPSEDFAAHLQKLVLTPLSALLSLFPGPQKLIQKRYDKLLD
YNSYLQRAAADESDLAKREYEALNAQLVEELQVFNLAARKILLNCLCSFVTLLRDLMTVA
QRVHTATVPVLQLASSISEIQNRVLEEVQNLNFVKDNNATFIERKLSFEKKKPVQTLPEV
PRQTDTHRSKLLSTYSTEELYQAKRKCNATQEYDINLLEGELVAVVEQKDPLGSTSRWLV
DTGIIKGYVYSSFLKPYNPARVQKVDAENRFCDDDFDNISLFVSSRPARDSVTGTPEGSI
SGSSSSLSGTCGKSEINGTDVDSFQEADEQV
Download sequence
Identical sequences W5PKQ4
ENSOARP00000011027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]