SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011243 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011243
Domain Number 1 Region: 695-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.52e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 779-834
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000656
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 3 Region: 365-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000388
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 532-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000868
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 453-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000112
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 740-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000803
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 7 Region: 622-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000286
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 8 Region: 824-875
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000408
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000011243
Domain Number - Region: 425-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000151
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 48-163
Classification Level Classification E-value
Superfamily SET domain 0.000801
Family Histone lysine methyltransferases 0.052
Further Details:      
 
Domain Number - Region: 176-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0262
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011243   Gene: ENSOARG00000010468   Transcript: ENSOART00000011403
Sequence length 1131
Comment pep:known_by_projection chromosome:Oar_v3.1:1:260137451:260183799:-1 gene:ENSOARG00000010468 transcript:ENSOART00000011403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDGNEEIMFIWCEDCSQYHDSECPELGPVVMVKDSFVLSRARSSLPSNLEIRRLEDGA
EGVFAVTQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDCNWMMLV
RPAAEPGHQNLTAFQHGSDVYFTTSRDIPPGTELRVWYAAFYATLRFGSHSRWACPAVST
AGAPENSTPVEAEPSQWACKVCSATFLELQLLNEHLLGHLEQSKSGAPAGQQESAPEKEA
DVPRGEPAEVPKTVSATKEQKKKPRRGRKPKTSKPEQPLVIVEGKEPAEQVTEIMTEVEP
VTATPDERIMELVLGKLAATPSDTSSVPKFPHHQSSTITLKRSLILSSRHGIRRKVVRQL
GEHRRVYQCSICSKVFQNSSNLSRHVRSHGDKLFKCEECAKLFSRKESLKQHVSYKHSRN
EGNGSARHACGTCEKTFRIQSALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKKHGDK
KFACEVCNKMFYRKDVMLDHQRRHLEGVRRVKREDVEAGGGENLVRYRKEPSGCPVCGKV
FSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFIGKI
GISSEENDDHSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMEVHKEKGYGCSICHRRFA
LKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACEQCG
KSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECRECHRKFA
QKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYM
LQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDA
SSIGIVQPELSLEQEELAEGKHVKATRRAPKRKQKPEEEAGATGPEDAAFSEFSEKEGTF
SGAVGDETDSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTTAGTQFTNLQPVAV
GHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDLQIHPQPEASNPQSVAHFINLTTL
VNSITPLGSQLGEQHPLTWRAGPPTERPPAPAPQAAQPSVPAEQQPQMYSY
Download sequence
Identical sequences W5PLC0
ENSOARP00000011243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]