SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011322 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011322
Domain Number 1 Region: 18-187
Classification Level Classification E-value
Superfamily RUN domain-like 1.31e-40
Family RUN domain 0.00099
Further Details:      
 
Domain Number 2 Region: 536-598,672-706
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000558
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 3 Region: 607-715
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000523
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000011322
Domain Number - Region: 927-979
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0624
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011322   Gene: ENSOARG00000010551   Transcript: ENSOART00000011482
Sequence length 985
Comment pep:known_by_projection chromosome:Oar_v3.1:11:44507177:44560970:-1 gene:ENSOARG00000010551 transcript:ENSOART00000011482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGVENGLDPRAAIPVIKKKLVGSVKALQKQYVSSDAVVTSEDGDANSMCSALEAVFIH
GLHAKHIRAEAGGKRKKGAHQKPLPQPVFWPLLKAVTHKHIISELEHLIFVSTDVGRCRA
WLRLALNDGLMECYLKLLLQEQARLCEYYQPTALLRDAEEAEFLLSFLQGLTSLSFELSY
KSAILNEWTLTPLALSGLCPLSELDPLTTPGAELQRKESLDSISHSSGSEDIEVQHSGHK
IRRNRQLTASSLSLDTASSSQLSCSLNSDSCLLLQENGSKSPDRSEEPMSYDSDLGMANA
DDSDMSLQEVLSEFSKAQVNSVPANEPSRETEVLTLQAPLLPGLNTSTSLHLEEPAEPCH
AQASPGTGDGDHKQEPLAQVPGALGWPQLGPAQAVLSGSASGQQPPHPKRDATRAASQES
GQQKPPEDGGPRLSLAVPSPTSPKSKSWISEDDFYRPPREQPRESPSDAATASPRGIPEA
RPGLLVQEPRRSCSMEALDKACAPSPGSERSRPAPAPPDHRNFRVVHRRQMGLSNPFRGL
LKLGTVERRGAMGIWKELFCELSPLELRLYLSGKERTCVDTCSLLRCESVGPAHSDGRFE
LLWSFSQVPEPDAIKESLLYLYTDRTWMPYIFSLSLESLKCFRVRNNEKMLSDSHGVETI
RDILPDTSLGGPAFFKIITAKAILKLQAGNAEEAALWRDVLRKVLASYLETAEEAVTLGG
SLDESCQEVLKFATRENGFLLQYLVAIPTEKGLDSQGCFCAGCSRQIGFSFVRPKLCAFS
GLYYCDICHQDDASVIPARIIHNWDLTKRLVCRQALKFLTQIRAQPLINLQLVNASLYEH
VEQMRLIGRSREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESPHKYSVADLQQIADG
VYEGFLKALIEFASQHVYHCDLCTQRGFICQICHHHDIIFPFEFDTTVRCGECKTVFHQT
CQAVVKKGCPRCARRRKYQEQSNLT
Download sequence
Identical sequences W5PLJ9
ENSOARP00000011322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]