SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011681 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011681
Domain Number 1 Region: 39-156
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-31
Family C-type lectin domain 0.00000709
Further Details:      
 
Domain Number 2 Region: 252-318
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 197-262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000681
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 157-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family EGF-type module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011681   Gene: ENSOARG00000010897   Transcript: ENSOART00000011849
Sequence length 372
Comment pep:known_by_projection chromosome:Oar_v3.1:12:35493849:35517906:-1 gene:ENSOARG00000010897 transcript:ENSOART00000011849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPWKCQNVQRGLWNVFKLWVWIMLCCDFFAHRGTDCWTYHYSKRPMPWEEARAFCRRN
YTDLVAIQNKGEIEYLNKTLPFSRTYYWIGIRKVEGVWTWVGTNKSLTEEAKNWGEGEPN
NRKSKEDCVEIYIKRIKDSGKWNDDACHKAKRALCYTASCKPWSCSGHGQCVEVINNYTC
SCDLGYYGPECQFVTQCVPLEAPKLSTMTCTHPLGNFSFMSQCAFNCSKGTDIIGIEETT
CGPFGNWSSPEPTCQVIQCEPLTEPDLGTMDCNHPLVDFGFSSTCTFSCSEEAELIGEKK
TICGLSGNWSSPSPKCQKVNRTISINEESDYNPLFIPVAVMVTAFFGLAFIIWLARRLKK
SKKSRRSTVDAY
Download sequence
Identical sequences W5PMK6
XP_004013726.1.66739 XP_011966836.1.54773 ENSOARP00000011681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]