SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011683 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011683
Domain Number 1 Region: 48-165
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-31
Family C-type lectin domain 0.00000709
Further Details:      
 
Domain Number 2 Region: 262-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 207-272
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000723
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 167-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000368
Family EGF-type module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011683   Gene: ENSOARG00000010897   Transcript: ENSOART00000011851
Sequence length 383
Comment pep:known_by_projection chromosome:Oar_v3.1:12:35503762:35517933:-1 gene:ENSOARG00000010897 transcript:ENSOART00000011851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAKGRSKAMLCPWKCQNVQRGLWNVFKLWVWIMLCCDFFAHRGTDCWTYHYSKRPMPWE
EARAFCRRNYTDLVAIQNKGEIEYLNKTLPFSRTYYWIGIRKVEGVWTWVGTNKSLTEEA
KNWGEGEPNNRKSKEDCVEIYIKRIKDSGKWNDDACHKAKRALCYTASCKPWSCSGHGQC
VEVINNYTCSCDLGYYGPECQFEVTQCVPLEAPKLSTMTCTHPLGNFSFMSQCAFNCSKG
TDIIGIEETTCGPFGNWSSPEPTCQVIQCEPLTEPDLGTMDCNHPLVDFGFSSTCTFSCS
EEAELIGEKKTICGLSGNWSSPSPKCQKVNRTISINEESDYNPLFIPVAVMVTAFFGLAF
IIWLARRLKKSGRKCTKPQKIKY
Download sequence
Identical sequences W5PMK8
ENSOARP00000011683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]