SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011870 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011870
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily C-type lectin-like 1.56e-34
Family C-type lectin domain 0.00000397
Further Details:      
 
Domain Number 2 Region: 241-306
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000107
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 3 Region: 296-363
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000959
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 178-250
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000681
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 5 Region: 360-422
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000122
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011870   Gene: ENSOARG00000011075   Transcript: ENSOART00000012044
Sequence length 484
Comment pep:known chromosome:Oar_v3.1:12:35526269:35536270:-1 gene:ENSOARG00000011075 transcript:ENSOART00000012044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASQYLSALTFVLLFKESRTWSYHASTEIMTFEAARDYCQKTYTALVAIQNQEEIEYLN
STFSHSPSYYWIGIRKINGTWTWIGTNKSLTKEATNWAPGEPNNKQTDEDCVEIYIKREK
DSGKWNDENCTKKKFALCYKAACTPTSCSSHGECVETINSHTCQCHPGFKGLRCEQVVTC
QAQKHPEHGHLVCNPLGKFTYNSSCSISCAEGYLPSSTEAARCMSSGEWSTPLPKCNVVK
CDALSNPDNGVVNCSQNHGSLPWNTTCMFECQEGYKLTGPQHLQCTSSGIWDNKQPTCKA
VTCAAISHPQNGTVKCSHSLVGEFAFKSSCHFTCAEGFALQGPAQVECTAQGRWTQQVPV
CEVVRCSRLDVSGKLNMNCNGEPVLGTECMFACPEGWTLNGSVALTCGATGHWSGMLPTC
EAPTVSQTPLAVGLSTAGVSLVTIPSFLFWLLKRLQKKAKKFSPASSCSSLKSNGCYSTP
SELV
Download sequence
Identical sequences W5PN45
ENSOARP00000011870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]