SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012098 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012098
Domain Number 1 Region: 492-795
Classification Level Classification E-value
Superfamily L domain-like 6.12e-46
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 2 Region: 21-437
Classification Level Classification E-value
Superfamily L domain-like 1.3e-38
Family Ngr ectodomain-like 0.0039
Further Details:      
 
Domain Number 3 Region: 883-1039
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-34
Family Toll/Interleukin receptor TIR domain 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012098   Gene: ENSOARG00000011288   Transcript: ENSOART00000012274
Sequence length 1050
Comment pep:known chromosome:Oar_v3.1:X:10344925:10361543:1 gene:ENSOARG00000011288 transcript:ENSOART00000012274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPMWTLKRQFPILFNMILISELLGARWFPKTLPCDVTLDAPNAHVIVDCTDKHLTEIP
GGIPANATNLTLTINHIAGISPASFHRLDHLVEIDFRCNCIPVRLGPKDNVCTKRLQIKP
NSFSKLTYLKSLYLDGNQLLEIPQDLPPSLQLLSLEANNIFLIMKENLTELANLEILYLG
QNCYYRNPCNVSFTIEKDAFLNMRNLKLLSLKDNNISAVPTVLPSSLTELYLYNNIITKI
QEDDFNNLSQLQVLDLSGNCPRCYNVPFPCTPCENNSPLQIDLNAFDALTELQVLRLHSN
SLQHVPQRWFKNINKLKELDLSQNFLAKEIGDAKFLHLLHNLVNLDLSFNYDLQVYHAVI
NLSDAFSSLKKLKVLRIKGYVFKELNSLNLFPLRNLPSLEVLDLGTNFIKIADLSIFKQF
KTLKFIDLSVNKISPSGDSTEGGFCSNMRTSVEGHGPQVLEALHYFRYDEYARSCRSKSK
EPPSFLPLNEDCYMYGQTLDLSRNNIFFIKSSDFQHLSFLKCLNLSGNSISQTLNGSEFQ
PLVELKYLDFSNNRLDLLYSTAFEELHNLEVLDISSNSHYFQSEGITHMLNFTKNLKVLK
KLMMNYNDIATSTSRTMESESLQILEFRGNHLDILWRDGDNRYLKFFKNLLNLEELDISE
NSLSFLPLGVFDSMPPNLKTLSLAKNGLKSFSWKGLQSLKNLETLDLSFNQLKTVPERLS
NCSRSLKKLILKNNQIRCLTKYFLQGAFQLRHLDLSSNKIQVIQKTSFPENVLNNLNILF
LHHNRFLCNCDAVWFVWWVNHTEVTIPYLATDVTCMGPGAHKGQSVVSLDLYTCELDLTN
FILFSLSISAVLSLMMITTANHLYFWDVWYSYHFCKAKIKGYRRLISPNSCYDAFIVYDT
KDPAVTEWVLDELVAKLEDPREKCFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTD
KYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPLQKSKFLQLRKRLCGSSVLEWPTNP
QAHPYFWQCLKNALATDNHVTYSQVFKETA
Download sequence
Identical sequences W5PNS2
ENSOARP00000012098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]