SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012774 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012774
Domain Number 1 Region: 90-210
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000201
Family PX domain 0.0036
Further Details:      
 
Domain Number 2 Region: 292-347
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000113
Family SAM (sterile alpha motif) domain 0.0066
Further Details:      
 
Domain Number 3 Region: 777-807
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000698
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012774   Gene: ENSOARG00000011914   Transcript: ENSOART00000012961
Sequence length 831
Comment pep:known_by_projection chromosome:Oar_v3.1:14:12488411:12531818:-1 gene:ENSOARG00000011914 transcript:ENSOART00000012961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGGGGPGGKSTLPTCPACHKVTPRPEPPVSSV
SNSLENALHTSTHSTEGSLPKRPGGKLSRVTVEKIDLKGLSHKKNERNVECSFEVLWSDS
SITSVTKSSSEVTEFISKLSQLHPEENLEKFIPCLAGPDSFYVERNHMDLEADLRYLASL
PSHVLKNDHVKKFFSTSSPTQQLQSPSPGNPSLSKVGTMMGVSGRPVCGVAGIPSSQGSA
QHHVQHAASAAALPHCSHSGGAGSALAYRTPMDSSPAILMPSSLQAPQTQEQNGILDWLR
KLRLHKYYPVFKQLTMESKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCLNP
SAPPPVSSSGVARVPPTTHLGPVQTVRGSHAAALRVEVEQAPHQTAREGSSSECSSSSPS
PMGVQAREESSDSAEENDRRVEIHLEGPDKEKPVMLLNHFTSSSARPTAQVLPVQNEAGS
TPSGHHSLPPQMMTAVRMLNSVHKAERGGTDMKLLSSSVHSLLSLEERSKVSGPRSSIKV
DKSFGNTMMDVLPSSTPHQPMQVLSGLAESSSVSPTVSFGPRTKVVHASALDRVMKPAQQ
PALVVEASTAAAGTSSTVFHVARPPIKLLVSSSVPADSAISGQTSCSNNVQISVPPAIIN
PRTALYTANTKAAFSAMSSVPVGPLQGSFCANSNTAASSSHPSPSFANMATVPSCPAPSS
SPALSSVPESSFYSSSGGGGGGGGSSPGNLPASAQNHHHHHRGGGGLCQAQGLVGSSNGS
SHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences W5PQP7
ENSOARP00000012774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]