SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013022 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013022
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-39
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000463
Further Details:      
 
Domain Number 2 Region: 242-326
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.41e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000172
Further Details:      
 
Domain Number 3 Region: 392-452
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000523
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013022   Gene: ENSOARG00000012145   Transcript: ENSOART00000013211
Sequence length 464
Comment pep:known_by_projection chromosome:Oar_v3.1:X:53139536:53146837:-1 gene:ENSOARG00000012145 transcript:ENSOART00000013211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPSGGRPGGRGGQGVQQNIPSTLLQDHENQQLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKGHCGAVCFVKDNPKKSYFIRLYGLQAGRLLWEQELYSQLVYSAPTPFFHTFAGD
DCQAGLNFADEGEAQAFRNLVQEKIQKRNQRQSGDRRQLPPPPVPASEERRGGLPPLPPH
PGGDQGGPAASPVSLGLVTVDIQNPDITNSRYRSLPAPGPGPSDKKRSGKKKISKSDIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISDAQLTDAETSKFIYDFIENQGGM
EAVRKEMRRQEPLPPPPPPSRGGNQPPRPPTVGSNKGRSGPLPPVPSGGAPPPPTPRGPP
PPGRGGPPGDGPIPPPPPPSLGLVGGPAPGGGRGALLDQIRQGIQLNKTPGAPESSALQP
PPQSSEGLVGALMHVMQKRSKAIHSSDEGEDQAGDDDDDDEWDD
Download sequence
Identical sequences W5PRE3
ENSOARP00000013022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]