SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013337 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013337
Domain Number 1 Region: 8-167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-43
Family Dual specificity phosphatase-like 0.000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013337   Gene: ENSOARG00000012445   Transcript: ENSOART00000013533
Sequence length 173
Comment pep:known_by_projection chromosome:Oar_v3.1:9:13025928:13029439:-1 gene:ENSOARG00000012445 transcript:ENSOART00000013533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVTYRNMRFLITHNPTNATLSKFIEELKKYGVTTIVRVCEATYDTTLVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREDPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Download sequence
Identical sequences G5E526 L8IZS3 W5PSA8
ENSOARP00000013337 9913.ENSBTAP00000002933 ENSBTAP00000002933 NP_001193053.1.59421 NP_001193053.1.76553 XP_005888201.1.15283 XP_010839106.1.44457 XP_012028066.1.54773 XP_012028067.1.54773 XP_012028068.1.54773 XP_014953184.1.66739 XP_014953185.1.66739 XP_014953186.1.66739 XP_017914290.1.57651 XP_017914292.1.57651 XP_017914293.1.57651 XP_020734883.1.74333 XP_020739326.1.74333 XP_020739327.1.74333 XP_020739328.1.74333 ENSBTAP00000002933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]