SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013650 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013650
Domain Number 1 Region: 780-873
Classification Level Classification E-value
Superfamily Immunoglobulin 6.13e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 1068-1162
Classification Level Classification E-value
Superfamily Immunoglobulin 2.57e-22
Family I set domains 0.0035
Further Details:      
 
Domain Number 3 Region: 876-970
Classification Level Classification E-value
Superfamily Immunoglobulin 2e-21
Family I set domains 0.0045
Further Details:      
 
Domain Number 4 Region: 324-419
Classification Level Classification E-value
Superfamily Immunoglobulin 2.16e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 5 Region: 1164-1251
Classification Level Classification E-value
Superfamily Immunoglobulin 5.98e-19
Family I set domains 0.0056
Further Details:      
 
Domain Number 6 Region: 133-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-18
Family I set domains 0.0093
Further Details:      
 
Domain Number 7 Region: 422-509
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 8 Region: 972-1066
Classification Level Classification E-value
Superfamily Immunoglobulin 8.21e-17
Family I set domains 0.0033
Further Details:      
 
Domain Number 9 Region: 687-777
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000179
Family I set domains 0.0073
Further Details:      
 
Domain Number 10 Region: 228-322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000187
Family I set domains 0.01
Further Details:      
 
Domain Number 11 Region: 39-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000189
Family I set domains 0.0063
Further Details:      
 
Domain Number 12 Region: 593-684
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000721
Family I set domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013650   Gene: ENSOARG00000012746   Transcript: ENSOART00000013854
Sequence length 1340
Comment pep:known_by_projection chromosome:Oar_v3.1:X:98298423:98322570:1 gene:ENSOARG00000012746 transcript:ENSOART00000013854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLEKPGEGATMLRTFTLLLFCAGLSLGVTPMGMTAVMPSQPELWIESNYPQAPWENITL
WCKSPSQISSKFLLLKDKTQMTWIRPSRKTFQVSFPIGALTQANTGLYRCCYWKETGWSE
PSKVLELEAPGQLPKPIFWIQTETSPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQV
PTGRVAIFSIANMTPESEGVYICRTHIQMLPTLWSEPSNPLKLIVAGLYPKPTLTAYPGP
IMAPGESLNLRCQGPIYGMTFALIRLEDLEKSFYLKRPIKNEAYFFFRALKIHDAGHYLC
FYYDGSYRGSLLSDILKIWVTDTFPKTWLLAQPSPVVQMGQNVSLWCRGPVDGVGLALYK
KGEDKPLQLLDTTSIYDDTSFFLNNVTSSDAGIYSCHYLLSWKTSIRMTSHNTVELVVVD
KPPKPSLSAWPSTVFKLGKAITLQCRVPHPVLEFCLEWEERATSPKFSVDGDFIISNVEG
KGAGTYSCSYRIEAHPNIWSHRSEPLKLMGPAGFLTWNHVLNETIRLFLVIQLVALLFVV
LWIRWKCRRLRIREAWLLGTAQGVTMLFILTALLCCGLCTGVLTEETEIIMPTPKPELWA
ETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQTHTG
SYHCHSWEEMAVSEPSEALELVGTDILPKPVISASPPIRGQELQIRCKGWLAGMGFALYK
EGMQEPVQQLGAVGREGFFTIRRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMY
PKPFFETWTSPVVTPGSRVTFNCSTPHQHMSFILYKDGSEVASSDSSWASLGASAAHFLI
ISVGIGDGGNYSCRYYDFAIWSEPSDPVELVVTEFYPKPTLLAQPGPVVLPGKNVTLRCQ
GAFQGMRFALLQEGTLGPLQFRSASGNSADFLLHTVGAEDSGNYSCVYFETTMSNRGSYL
SKPLMIWVTDTFPKPRLFAEPSSVVPVGQNVTLWCQGPVQGVGYILHKEIEATSVQLWGS
TSNDGAFPITNISGASIGRYSCCYHPDWTSLIKIQPSNTLELIVTGLLPKPSLLAQPGPM
VAPGENMTLQCQGELADSTFVLLKKGIQEPLKQQRPNGYRADFWMPAVSSEDSGMYSCVY
YLDSAPLAASNHSDSLEIWVTDKPPKPSLSASPGTVFKLGKDITLQCRGPLPGVEFVLEH
DGEEAPQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDTLELVGAAGPAAQE
CTVGNIVRSTLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGDLGT
NTNSPSSVSQGTSVEQPVPI
Download sequence
Identical sequences W5PT69
ENSOARP00000013650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]