SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013700 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013700
Domain Number 1 Region: 40-196
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 4.58e-25
Family ENV polyprotein, receptor-binding domain 0.0012
Further Details:      
 
Domain Number 2 Region: 457-508
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0000000000000025
Family Virus ectodomain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013700   Gene: ENSOARG00000012793   Transcript: ENSOART00000013905
Sequence length 508
Comment pep:novel chromosome:Oar_v3.1:16:48883132:48884676:1 gene:ENSOARG00000012793 transcript:ENSOART00000013905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVQPLEAKASKAPTGPGQLGWAILWMTHLLCSGVASVNPHQPVKITWKLQNGLTREVLN
STTAIHPPNTWWLDLYFYLKPMVNVPWARGYLREQGFWACPGTCGGGVGGGAQDSYCKTW
DCVTSNDGPQCWEVRNRDLLNFSFAKPLPRVLGDPTFSCESCNYAQVRIRSNQEKSKKEG
TWISGLSWGLQTRESGGFGVDGKGIIVVSQVLEPILVHSIGPNKVEKLAVTPRLTTSMPT
SLAVSPEAEALAEIDPLWKLIRAAYATLNQTHPEATKSCWLCYNLIPPYYEAVGLNASYD
LANSTDPPQCHWGDRKVGLTMKEVWGKGLCMGTVLPAKSPLCVHVVEPDDLPVAKWLIPQ
MGGWWVCSHTGLTPCLHSSIFDPKEEFCVMVAVMPKILYRPEKAIYDYWAQKLTLNPPKR
TYKVKREPLTVITIATMFGLGIAGAGTGITALSLQGQGFNSLRAAIDEDITRIEQSISHL
ESSLTSLSEVVLQNRRGLDLLFLQQGGL
Download sequence
Identical sequences W5PTB9
ENSOARP00000013700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]