SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013772 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013772
Domain Number 1 Region: 132-195
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000175
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 2 Region: 33-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000012
Family Complement control module/SCR domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013772   Gene: ENSOARG00000012860   Transcript: ENSOART00000013977
Sequence length 285
Comment pep:known chromosome:Oar_v3.1:13:10486689:10528633:-1 gene:ENSOARG00000012860 transcript:ENSOART00000013977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVIPGARRMEPSLLMWRFFVFIVVPGCVTEACHDDPPSLRNAMFKVLRYEVGTMINCD
CKAGFRRVSAVMRCVGDSSHSAWNNRCFCNSTSPAKNPVKPVTPGSEEQRERKPTDAQSQ
TQPPEQADLPGHCEEPPPWEHEREPLKRVYHFTLGQTVHYQCAQGFRALHTGPAESTCTM
IHGEMRWTRPRLKCISEGANSQAPDEAEPPESTEAPPGSGTFLTTRMAGTTDFQKPTDVV
ATLDTFIFTTEYQIAVAGCILLLSSILLLSCLTWQRRWKKNRRTI
Download sequence
Identical sequences W5PTJ1
ENSOARP00000013772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]