SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014288 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014288
Domain Number 1 Region: 780-978
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.11e-48
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 1018-1216
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-45
Family BAR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 242-305
Classification Level Classification E-value
Superfamily SH3-domain 1.05e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 1507-1574
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-17
Family SH3-domain 0.0000185
Further Details:      
 
Domain Number 5 Region: 143-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000158
Family SH3-domain 0.00092
Further Details:      
 
Domain Number 6 Region: 1283-1359
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000236
Family SH3-domain 0.00000817
Further Details:      
 
Domain Number 7 Region: 4-62
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000696
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 8 Region: 68-134
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000236
Family SH3-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014288   Gene: ENSOARG00000013330   Transcript: ENSOART00000014496
Sequence length 1577
Comment pep:known_by_projection chromosome:Oar_v3.1:22:20004847:20084326:-1 gene:ENSOARG00000013330 transcript:ENSOART00000014496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAIFDFCPSVSEELPLFVGDIIEVLAVVDEFWLLGKKEDVTGQFPSSFVEVVT
IPSLKEGERLYVCICEFTSLELNSLPLHRGDLVILDGTLTGGWLQGRNCWGARGFFPSSC
VRELCLSSQSRQWHSQSALLQIPEYSMGQARALMGLSAQLDEELDFREGDVITIIGIPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDESVSSGNCDDCISNGEVDTGTGEEKEPEEDS
EQPGTYGIALYRFQALEPNELDFEVGDKIRILGTLEDGWLEGSLKGRTGIFPYRFVKLCP
QTRVEETVDLSQESDLTNIPDTPLDCSENSLEAEGNRHEFHEYEAEKSNCVISETSSVST
PEHLTSECEENKQSYWDADPSGGPPRSPSAGQEEVFVQCSSTKDPSEVVNGVASQPPVPF
HPELQRNQYYSMRGGSHPSPDQYSDSLPPEARTRDYSSLPPRRTSYSQPKTLQKPGPPLH
SASSLTASRAVRPSQLSSQLHGLARCVKKHCTPKESASSFCSAPDRPEMKPGLQDKAPAL
EAMARFQGEGSTDLDSKLTQQLIEFEKSLSGPFPEPDKILRHFSIMDFNSEKDIFRGSSK
LMTQQELPERRKALRPPPPRPCTPASTPHHVPGDQNLRLDPPLAVRPSRPAPLPPSAQQR
TNAVPPKLLTCNRPGWESLEKEGPENVDKTLDQTSQCPLVLVKIQEMEQDLDMCRRAQEE
LNLLLEEKQEESLRAETLQNLEFYENNIESLNMELQQLREMTLLSSQSSSLMAPSGSVST
ENPEQRMLEKRAKVIEELLQTERDYIRDLEMCIERIMVPLQLAQIPNIDFEGLFGNMQMV
IKVSKQLLTDLEISDNIGPVFLDHRDELEGTYKVYCQNHDEAISLLEIYEKDEKIQKHLQ
DSLADLKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAV
LAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGF
APQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVSMWDVCMEKGH
RDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNC
TERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQGLFSNCVHGYAEAHCDFV
RQALEQLKPLLSLLKVTGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPTTKRPFERKTM
DRQSTRKPLLGMPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGV
IKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNARRSHSDASVGSHSSTESEHGSSSPRL
PPLPRRQNSGGTLTFNPSSMAVSFSSGPCQKQPPDASSQTEFDQGTLSASLNSEGSPSRC
PSDPDSPSQHRPWDSGDAVRDLPQACPYPRPPEMAGSSMSGRNGQGRDLVKAGARTALSL
DDRHEQPESSEAEGNQVYFAVYTFKARNPNELSVSANQRLKILEFKDVTGNTEWWLAEVN
GKKGYVPSNYIRKAEYT
Download sequence
Identical sequences W5PV06
ENSOARP00000014288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]