SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014632 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014632
Domain Number 1 Region: 182-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.92e-59
Family Dystroglycan, domain 2 0.000000386
Further Details:      
 
Domain Number 2 Region: 502-602
Classification Level Classification E-value
Superfamily Cadherin-like 9.73e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 1.88e-18
Family Dystroglycan, N-terminal domain 0.00000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014632   Gene: ENSOARG00000013645   Transcript: ENSOART00000014847
Sequence length 900
Comment pep:known_by_projection chromosome:Oar_v3.1:19:50560290:50574468:-1 gene:ENSOARG00000013645 transcript:ENSOART00000014847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVGPSLWLPLWGRTFLLLLSVAMAQSHWPSEPSEAARDWENQLEASMHSALSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASNGEVIKVSAAGKEALPSWLHWDPRSHTLEGL
PLDTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHSEPQSLRAASPDPGEVVSS
VCAADEPVTVLTVILDADLTKMTPKQRIDLLRRMRGFSEVEPHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCALNQNSVPDIRGVEVPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIVQTPTLGPIQPTRVSEAGTTVPSQIRPTMTIPGYVEPTAVITPP
TMTTRKPRVSTPRVPPPRPATPSTDSSTATTRRPTKKPRTSRPVPRVTTKAPITRLETAS
PPTRIRTTTSGVPHGREPNQGPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLK
LTLKLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHV
HRRPQGDKAPARFKAKLTGDPAAVTNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSI
VVEWTNNTLPLEPCPKEQITALSRRIAEDDGKPRAAFVNALEPDFQAMSITVTGSGSCRH
LQFVPAAPPRRVPSEAPATEVPDRDPERSSEDDVYLHTVIPAVVVAAILLIAGIIAMICY
RKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQS
VPETTPLNQDTVGEYAPLRDEDPSAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences W5PVZ9
XP_004018507.1.66739 ENSOARP00000014632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]