SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014725 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014725
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily RUN domain-like 2.62e-21
Family RUN domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014725   Gene: ENSOARG00000013712   Transcript: ENSOART00000014943
Sequence length 226
Comment pep:known_by_projection chromosome:Oar_v3.1:4:32644654:32815080:1 gene:ENSOARG00000013712 transcript:ENSOART00000014943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKQLTEHKGKGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGML
LGLNAIDFSSDSISSDEEELRTLGSSDSESSTPEKAGPPVIMDENSWFNKCKRVKQKYQL
TLEQKGYLEELLQLRENQLSESVAQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTV
LKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWY
Download sequence
Identical sequences W5PW92
ENSOARP00000014725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]