SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014904 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014904
Domain Number 1 Region: 123-196
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-16
Family Complement control module/SCR domain 0.00031
Further Details:      
 
Domain Number 2 Region: 248-311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 3 Region: 180-250
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000764
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 4 Region: 75-133
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000089
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014904   Gene: ENSOARG00000013891   Transcript: ENSOART00000015124
Sequence length 362
Comment pep:novel chromosome:Oar_v3.1:12:73705977:73737242:-1 gene:ENSOARG00000013891 transcript:ENSOART00000015124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASCAPRKAPPRCSERLASSGRFAGVLLLAPLLVLPASSDACGDPPRFVTMKPKADPAS
SYSPGFVTVTPQGNTTSGYPPGHRILYECRLGFQPVTPGQVLALVCQENKTWSSLQEGCK
RKQCSNLADPTNGQVIFVNESMEFGSQAHYVCNQGYYLIGTSISHCDISGDGVDWSDHPP
TCEKVLCKPPKEIPNGKYTNSHKDIFEYNEVVTYSCDPSNGPDEYSLIGESRLICVGNDE
WSSQPPQCKVVKCEYPAVENGTIVSGHGHKFYYKATVVFKCNEGFDLHGNNIVVCGENST
WEPELPKCIKGHPSPTDATPPNDAEGLGAGFIVLIVIALLVGIGVLLCLYFFLCRQKKKG
LK
Download sequence
Identical sequences W5PWS1
ENSOARP00000014904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]