SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015143 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015143
Domain Number 1 Region: 29-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.93e-78
Family BAR domain 0.00000000174
Further Details:      
 
Domain Number 2 Region: 299-362
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015143   Gene: ENSOARG00000014106   Transcript: ENSOART00000015363
Sequence length 367
Comment pep:known_by_projection chromosome:Oar_v3.1:2:85475187:85651232:1 gene:ENSOARG00000014106 transcript:ENSOART00000015363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFGGGRGLPGHSTQQTEARGSRVCLPQQKVSEKVGGAEGTKLDDDFKEMERKVDVTSR
AVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELG
DDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRR
LDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEY
HKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFSTGDSTQPNGGLSHTGTPKP
AGAPMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVE
ILVALPH
Download sequence
Identical sequences W5PXF9
ENSOARP00000015143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]