SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015208 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015208
Domain Number 1 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 62-122
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 417-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 228-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.7e-18
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015208   Gene: ENSOARG00000014166   Transcript: ENSOART00000015429
Sequence length 479
Comment pep:known_by_projection chromosome:Oar_v3.1:3:104411730:104421025:-1 gene:ENSOARG00000014166 transcript:ENSOART00000015429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPRPNYGWERGRQNSLRRRTGFPTRRGSVFLGPEQSVPEDSALLCKESTLEGMAAVSP
TRCQDPVTFEDVAIVFTDEEWRSLVPTQRDLYKEVMLENYKSIVSLGLPIPGPDVIFQLK
RGDEPWLVEFHEFEGKEGAENVSLDWETKPEIQGASEEGKSEGSLKEKLGRKGPPSPKFE
VYVLDGRLGTEKESPTVEACKKPPSLEESLQHRAAPPKKFLTKERDQECSNCGKTFFDHS
SLIRHQRTHTGEKPYDCPECGKAFSHRSSLSRHLMSHTGESPYECSACGKAFFDRSSLTV
HQRIHTGEKPFKCSECGKAFFDRSSLTRHQRIHTGESPYECNQCGKAFSQKSILTRHQLI
HTGRKPYECNECGKAFYGVSSLNRHQKAHAGEPRYQCSECGKAFFDRSSLTQHQKIHTGD
KPYECSECGKAFSQRCRLTRHQRVHTGEKPFECSVCGKVFSSKSSVIQHQRRYAKQGID
Download sequence
Identical sequences W5PXM4
ENSOARP00000015208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]