SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015349 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015349
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-75
Family BAR domain 0.0000000799
Further Details:      
 
Domain Number 2 Region: 270-330
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-21
Family SH3-domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015349   Gene: ENSOARG00000014300   Transcript: ENSOART00000015573
Sequence length 333
Comment pep:known_by_projection chromosome:Oar_v3.1:18:22986067:23039888:1 gene:ENSOARG00000014300 transcript:ENSOART00000015573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLFSEKISGVEGTKLDDEFLDMERKIDITNKAVAEILSKATEYLQPNPAYRAKLGMLNTV
SKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEGSTFGSALIEVGESMKLMAEVKDSLDIN
VKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESK
ELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQSKLQMRISAASNVPKRE
YKPRPIKRSPSELNGVSTAASAKTTGSNAPVDQPCCRGLYDFEPENQGELGFKEGDIITL
TNQIDENWYEGVLRGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences W5PY15
ENSOARP00000015349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]