SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015574 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015574
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 7.19e-28
Family ENV polyprotein, receptor-binding domain 0.00073
Further Details:      
 
Domain Number 2 Region: 402-454
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0000000000002
Family Virus ectodomain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015574   Gene: ENSOARG00000014519   Transcript: ENSOART00000015804
Sequence length 454
Comment pep:novel chromosome:Oar_v3.1:3:106494327:106495744:-1 gene:ENSOARG00000014519 transcript:ENSOART00000015804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPHQPVKITWKLQNGLTREVLNSTTAIHPPNTWWPDLYFDLKPMVNVPWARGYLREQGFW
ACPGTPRHDWKTCWGAQDSYCKTWDCVTSNDGPRRWEVGNRDLLNFSFAKPLPRVLGDPT
FSCESCNYAQKKGKKEGTWISGLSWGLQTRESGGFGVDGQFLYTVSGPKKVEKLAVTPCL
MTSMPTSLAVSPEAEALAEIDPLWKLIRAAYATLNQTHPEATKSCWLCYNLIPPYYEAVG
LNASYDLANSTDPPQCHWGDRKVGLTMKEVWGKGLCMGTVLPAKSPLCVHVVEPDDLPVA
KWLIPQMGGWWVCSHMGLTPCLHSSIFDPKEEFCVMVAVMPKILYRPEKAIYDYWAQKLT
LNPPKRTYKVKREPFTAITIATMFSLGIAGARTGITALFLQSQGFNSLRAAIDEDITRIE
QSISHLKSSLTSLSEVVLQNRRGLDLRSLQQGGL
Download sequence
Identical sequences W5PYN9
ENSOARP00000015574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]