SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015946 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015946
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.01e-69
Family BAR domain 0.00044
Further Details:      
 
Domain Number 2 Region: 244-276,307-364
Classification Level Classification E-value
Superfamily SH3-domain 3.66e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015946   Gene: ENSOARG00000014861   Transcript: ENSOART00000016179
Sequence length 365
Comment pep:known_by_projection chromosome:Oar_v3.1:1:63242288:63282714:1 gene:ENSOARG00000014861 transcript:ENSOART00000016179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRASSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSSYHSNNNQTSVAPVPSASSNVIGSSALTSTSSLVIASPSNLTD
LKECSGSRRARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGRVPITY
LELLN
Download sequence
Identical sequences W5PZR0
XP_004002209.1.66739 XP_011990012.1.54773 ENSOARP00000015946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]